TY - JOUR U1 - Wissenschaftlicher Artikel A1 - Fan, Lu A1 - Warnecke, Athanasia A1 - Weder, Julia A1 - Preller, Matthias A1 - Zeilinger, Carsten T1 - Triiodothyronine Acts as a Smart Influencer on Hsp90 via a Triiodothyronine Binding Site JF - International Journal of Molecular Sciences N2 - Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC50 of 50 μM. The binding motif can influence the activity of Hsp90 by hindering ATP accessibility or the release of ADP. KW - HSP90 KW - thermophoresis KW - molecular docking KW - protein microarray KW - triiodothyronine Y1 - 2022 UN - https://nbn-resolving.org/urn:nbn:de:hbz:1044-opus-62922 SN - 1422-0067 SS - 1422-0067 U6 - https://doi.org/10.3390/ijms23137150 DO - https://doi.org/10.3390/ijms23137150 PM - 35806154 VL - 23 IS - 13 SP - 6 S1 - 6 PB - MDPI CY - Basel ER -