Refine
H-BRS Bibliography
- yes (761) (remove)
Departments, institutes and facilities
- Fachbereich Angewandte Naturwissenschaften (761) (remove)
Document Type
- Article (528)
- Conference Object (75)
- Part of a Book (65)
- Doctoral Thesis (26)
- Book (monograph, edited volume) (21)
- Report (19)
- Preprint (9)
- Contribution to a Periodical (6)
- Research Data (4)
- Conference Proceedings (2)
Year of publication
Keywords
- GC/MS (13)
- Lignin (13)
- Lehrbuch (8)
- cytokine-induced killer cells (8)
- lignin (8)
- immunotherapy (7)
- stem cells (7)
- Chemie (6)
- Chemometrics (6)
- drug release (6)
- Biomass (5)
- Chromatography (5)
- Explosives (5)
- Gene expression (5)
- Organic aciduria (5)
- Polymers (5)
- biomaterial (5)
- osteogenesis (5)
- scaffolds (5)
- Analytical pyrolysis (4)
- CD21 (4)
- Corrosion inhibitors (4)
- ENaC (4)
- Inborn error of metabolism (4)
- Ketolysis (4)
- Mass spectrometry (4)
- Mesenchymal stem cells (4)
- Miscanthus (4)
- Regenerative medicine (4)
- Scaffolds (4)
- Tissue engineering (4)
- active packaging (4)
- additive (4)
- angiogenesis (4)
- antioxidant (4)
- apoptosis (4)
- mesenchymal stem cells (4)
- organic aciduria (4)
- organosolv (4)
- pioglitazone (4)
- thiazolidinediones (4)
- tissue engineering (4)
- Analytische Chemie (3)
- Antimicrobial activity (3)
- Antioxidant activity (3)
- Arthritis (3)
- Composites (3)
- Crystallinity (3)
- DNA damage (3)
- DNA typing (3)
- Dielectric analysis (3)
- Failure analysis (3)
- Glycine conjugation (3)
- Isovaleric acidemia (3)
- K/BxN (3)
- Ketogenesis (3)
- Ketone body (3)
- Kriminalistik (3)
- Malaria (3)
- Metabolic acidosis (3)
- Miscanthus x giganteus (3)
- Molecular dynamics (3)
- NMR (3)
- Plasmodium (3)
- Primary long-chain alkyl amines (3)
- Pyrolysis (3)
- Raman spectroscopy (3)
- SERS (3)
- Stem cells (3)
- TD-GC/MS (3)
- alumina (3)
- autophagy (3)
- biomass (3)
- bone (3)
- bone tissue engineering (3)
- chemometrics (3)
- classification (3)
- cytokine-induced killer (CIK) cells (3)
- differentiation (3)
- extraction (3)
- extremophiles (3)
- extrusion blow molding (3)
- hydrogel (3)
- insulin resistance (3)
- metabolic acidosis (3)
- poly(lactic acid) (3)
- preceramic paper (3)
- scaffold (3)
- shedding (3)
- sustainability (3)
- type 2 diabetes (3)
- ultrapure water (3)
- 3-hydroxyisobutyrate dehydrogenase (2)
- 3-hydroxyisobutyric aciduria (2)
- ACAT1 (2)
- AOP (2)
- Additiv (2)
- Additives (2)
- Adipose tissue (2)
- Aluminiumoxid (2)
- Aminoacylase (2)
- Analytical Chemistry (2)
- Analytics (2)
- Analytik (2)
- Anoplophora glabripennis (2)
- Antioxidans (2)
- Antioxidant capacity (2)
- Automotive industry (2)
- B cell activation (2)
- Biomaterials (2)
- Biomineralization (2)
- Bone (2)
- CIK cells (2)
- Canavan disease (2)
- Cathepsin K (2)
- Classification (2)
- Complement receptor (2)
- Complement receptor 2/CD21 (2)
- Complex modulus (2)
- Cysteine proteases (2)
- DMA (2)
- DNA (2)
- DSC (2)
- Dental follicle (2)
- Deoxyhypusine hydroxylase (2)
- Diabetes (2)
- Differentiation (2)
- Discriminant analysis (2)
- Enzyme activity (2)
- Extrusion blow molding (2)
- Fatty acid metabolism (2)
- Folin-Ciocalteu assay (2)
- GC-FID/NPD (2)
- GLYCTK (2)
- Glycine N-acyltransferase (2)
- Graphene (2)
- HIBADH (2)
- HIBADH deficiency (2)
- HMGCL (2)
- HPLC (2)
- HSQC NMR (2)
- Humans (2)
- Hyperspectral image (2)
- IR microspectroscopy (2)
- Ion viscosity (2)
- Ketoacidosis (2)
- Ketone body utilization (2)
- Kinetics (2)
- Lignocellulose feedstock (2)
- Mars (2)
- Massenspektrometrie (2)
- Membrane Transport (2)
- Metabolic decompensation (2)
- Microorganisms (2)
- Mxi-2 (2)
- NMR spectroscopy (2)
- Nano-Systems (2)
- Organic acids (2)
- Organosolv lignin (2)
- Osteogenesis (2)
- Oxidative stress (2)
- Polymorphism (2)
- Principal Components Analysis (2)
- Prognosis (2)
- Pten (2)
- Py-EGA-MS (2)
- R-ratio (2)
- Raman microscopy (2)
- Raman-microspectroscopy (2)
- Renewable resource (2)
- Resins (2)
- Rheumatoid arthritis (2)
- SLC (2)
- Shedding (2)
- Short tandem repeat (STR) (2)
- Spectroscopy (2)
- Spektroskopie (2)
- Styrene (2)
- Sweet cherry (Prunus avium L.) (2)
- TNT (2)
- TOC (2)
- Thyme (2)
- Thymian (2)
- Type 2 diabetes mellitus (2)
- UV (2)
- VOC (2)
- Western Africa (2)
- Whole genome amplification (2)
- adhesion (2)
- aluminum bonding wire (2)
- antimicrobial activity (2)
- antioxidant activity (2)
- azadipeptide nitrile (2)
- bacteria (2)
- bio-based polymers (2)
- biobased (2)
- bioeconomy (2)
- blown film extrusion (2)
- bone regeneration (2)
- breast cancer (2)
- bulk detection (2)
- cardiovascular disease (2)
- cardiovascular risk (2)
- cell death (2)
- cell migration (2)
- coniferous woods (2)
- creep (2)
- cyanohydrazide warhead (2)
- cysteine proteases (2)
- d-Glycerate kinase deficiency (2)
- d-Glyceric aciduria (2)
- dielectric analysis (2)
- diffusion (2)
- discriminant analysis (2)
- essential oil (2)
- evolution (2)
- extraterrestrial analogue (2)
- extremophile (2)
- food loss (2)
- food waste (2)
- food-related bacteria (2)
- force generation (2)
- fruit quality (2)
- fungi (2)
- gas sensor (2)
- gas sensors (2)
- glimepiride (2)
- human cathepsins (2)
- identification (2)
- image fusion (2)
- improvised explosive devices (2)
- inborn error of metabolism (2)
- isoleucine (2)
- ketogenesis (2)
- ketolysis (2)
- ketone body (2)
- kraft lignin (2)
- leucine (2)
- library free detection (2)
- life detection (2)
- lifetime prediction (2)
- lignocellulose feedstock (2)
- low-input crops (2)
- mechanical properties (2)
- melanin (2)
- metabolic decompensation (2)
- migration (2)
- modeling (2)
- monolignol ratio (2)
- morphology (2)
- multivariate data processing (2)
- myosin (2)
- natural additives (2)
- nitrile inhibitors (2)
- osteoblast (2)
- osteoclast (2)
- ozonation (2)
- ozone (2)
- pansharpening (2)
- paper-derived ceramic (2)
- permeability (2)
- photolysis (2)
- photonic sensing (2)
- physical sensors (2)
- plant extracts (2)
- poly(butylene adipate terephthalate) (2)
- polymers (2)
- polyphenols (2)
- power electronics (2)
- pressure sensitive adhesives (2)
- protease inhibitor (2)
- reaction kinetics (2)
- rheology (2)
- shelf life (2)
- small-scale fatigue testing (2)
- stem cell (2)
- stress response (2)
- structure (2)
- sulfonylurea (2)
- sustainable packaging (2)
- thermo-mechanical properties (2)
- total phenol content (2)
- transdermal therapeutic systems (2)
- type 2 diabetes mellitus (2)
- (poly)saccharides (1)
- 1-MCP (1)
- 16S rRNA gene sequencing (1)
- 1H (1)
- 2B4 (1)
- 3-hydroxy-n-butyric acid (1)
- 3-hydroxyisobutyrate dehydrogenase deficiency (1)
- 3-hydroxyisobutyric acid dehydrogenase deficiency (1)
- 31P NMR (1)
- 3D activity landscapes (1)
- 3D-printing (1)
- 5-Oxoprolinase (1)
- 5-oxoprolinuria (1)
- ABTS (1)
- ACacylcarnitines (1)
- ADP release (1)
- AMAtypical myopathy (1)
- AMT (1)
- APC superfamily (1)
- ASIC (1)
- ASPA (1)
- ASR (1)
- ATB0,+ (1)
- ATF4 (1)
- ATF6 (1)
- ATPase cycle (1)
- ATR-FTIR (1)
- Abies nordmanniana (1)
- Abies procera (1)
- Abiotic stress (1)
- Acceleration (1)
- Accuracy (1)
- Acetylcholinesterase (AChE) (1)
- Acorns (1)
- Active site mapping (1)
- Activity-based probes (1)
- Acylpeptide hydrolase (1)
- Additive (1)
- Adipogenesis (1)
- Adipogenic effect (1)
- Adipose tissue-derived stem cells (1)
- AdoMETDC (1)
- Adsorption (1)
- Adult Stem Cells/physiology (1)
- Affinity proteomics (1)
- Agarose (1)
- Age estimation (1)
- Agglomerative Hierarchical Cluster Analysis (1)
- Aglaonema hookerianum (1)
- Ago2 (1)
- Aloe vera (1)
- Alzheimer’s disease (1)
- Aminoacylase 1 (1)
- Amplifiers (1)
- Amylose stationary phases (1)
- Analytics Internship (1)
- Analytik Praktikum (1)
- Angiogenesis (1)
- Ankle Joint (1)
- Ankle thickness (1)
- Antarctic Polar Plateau (1)
- Antarctic ice sheet (1)
- Antibodies* (1)
- Antibody Induced Arthritis (1)
- Antidepressant (1)
- Antioxidant assays (1)
- Antioxidanz (1)
- Antioxidative Capacity (1)
- Antioxidatives Potential (1)
- Antiphospholipid syndrome (APS) (1)
- Anxiolytic (1)
- Apheresis therapy (1)
- Aphrodisiac effects (1)
- Apple replant disease (1)
- Area under the curve (1)
- Articular Cartilage (1)
- Aspartic acid racemization (1)
- Aspartoacylase (1)
- Assay development (1)
- Assay reproducibility (1)
- Asymmetric cell division (1)
- Atherosclerosis (1)
- AuNPs (1)
- Aufgabensammlung (1)
- Autism (1)
- Autoantibody (1)
- Automated Coating (1)
- Automated PyMS (1)
- Automation (1)
- Automobilindustrie (1)
- Automotive Industry (1)
- Autophagy induction (1)
- B Defects (1)
- B Interfaces (1)
- B cells (1)
- B lymphocyte (1)
- BLAST (1)
- Bacillus (1)
- Bacteria (1)
- Bacteria, Anaerobic (1)
- Bactericidal effect (1)
- Bakterien (1)
- Basiswerkstoff (1)
- BcL-2 family (1)
- Bcl-2 (1)
- Beech wood (1)
- Benzoyl-coenzym A (1)
- Beta-ketothiolase (1)
- Beta-ketothiolase deficiency (1)
- Biaxiality (1)
- BioMark HD microfluidic system (1)
- Bioactive (1)
- Bioactive factors (1)
- Bioactivity (1)
- Bioaktiv (1)
- Bioaktive Verbindung (1)
- Bioaktivität (1)
- Bioassay (1)
- Biobased polymeric material (1)
- Biochemicals (1)
- Biochemische Analyse (1)
- Bioenergy (1)
- Biokompatibilität (1)
- Biological databases (1)
- Biological therapy (1)
- Bioluminescence (1)
- Biomarkers stability (1)
- Biomasse (1)
- Biomaterial (1)
- Biomaterialien (1)
- Biophysics (1)
- Biopolymers (1)
- Biorefinery (1)
- Biosignatures (1)
- Blood glucose meter (1)
- Bond strength (1)
- Bone marrow-derived stem cells (1)
- Breast cancer (1)
- Bulk detection (1)
- Bulk fill (1)
- C-19 steroid (1)
- CD146 (1)
- CD30+ cells (1)
- CD40 (1)
- CD40, CTLA-4 (1)
- CDH1 (1)
- CDKN1B (1)
- CFTR inhibitors (1)
- CFTR mutations (1)
- CIK-Zellen (1)
- CR2 (1)
- CTNNB1 (1)
- CYP2C19 (1)
- CYP2C8 variants (1)
- CYP2C9 (1)
- CYP2D6 (1)
- Caffeine-containing drinks (1)
- Calcium (1)
- Calcium Intracellular Release (1)
- Calorimetry (1)
- Camphorquinone (1)
- Cancer (1)
- Cannabinoids (1)
- Canola (1)
- Carbapenem (1)
- Carbon nanotubes (1)
- Carboxen-poly(dimethylsiloxane) (1)
- Carboxy-terminal fragments (1)
- Cardiovascular Disease (1)
- Cartilage Destruction (1)
- Catalyst Ink (1)
- Catalyst Layer (1)
- Catechins (1)
- Cathepsin B (1)
- Cathepsin S (1)
- Cathepsins (1)
- Cavities (1)
- Cell Cycle (1)
- Cell Differentiation (1)
- Cell Differentiation/physiology (1)
- Cell Signaling (1)
- Cell activation (1)
- Cell lineage (1)
- Cellulose (1)
- Cellulose stationary phases (1)
- Central sensitisation (1)
- Cervical cancer screening (1)
- Cervicovaginal microbiome (1)
- Chaetocin (1)
- Charakterisierung (1)
- Chemical calculations (1)
- Chemical imaging (1)
- Chemical resource (1)
- Chemical structure (1)
- Chemicals (1)
- Chemische Analyse (1)
- Chemometrie (1)
- Chemotherapy (1)
- Chiral stationary phases (1)
- Chiral-nematischer Flüssigkristall (1)
- Chlorophyll fluorescence (1)
- Christmas trees (1)
- Chromatogramm (1)
- Chromatographie (1)
- Chronic lymphocytic leukemia (1)
- Cislunar (1)
- Climate change (1)
- Collagen (1)
- Collision induced dissociation (1)
- Color/Spot-Test (1)
- Colposcopy (1)
- Complement (1)
- Complement receptor 2 (1)
- Complement receptor 2 /CD21 (1)
- Composite resin (1)
- Compressive strength (1)
- Confocal microscopy (1)
- Corrosion protction (1)
- Coumarins (1)
- Crack formation (1)
- Cucumber peel waste (1)
- Curie-point pyrolysis (1)
- Curing behavior (1)
- Curing depth (1)
- Curing kinetics (1)
- Cytokine (1)
- Cytokine-induced killer (CIK) cells (1)
- D Multilayer (1)
- D Nickel alloy (1)
- D Zirconium oxide (1)
- DBSdried blot spots (1)
- DIDMOAD (1)
- DMFC (1)
- DNA Transcription (1)
- DNA double- strand breaks (1)
- DNA extraction protocols (1)
- DNA interaction (1)
- DNA methylation (1)
- DNA profile (1)
- DNA profiling (1)
- DOSY (1)
- DPPH (1)
- Daptomycin (1)
- Data fusion (1)
- Defense and security (1)
- Degradation (1)
- Degradation products (1)
- Degraded DNA (1)
- Degree of conversion (1)
- Dehydrogenase (1)
- Dental (1)
- Dental composites (1)
- Dental material (1)
- Dental resin (1)
- Depth Of Cure (1)
- Derivatization with trifluoroacetic anhydride (1)
- Desinfektion (1)
- Detektion von Explosivstoffen (1)
- Development (1)
- Diabetes mellitus (1)
- Diaminphenylderivat (1)
- Didaktik (1)
- Dielectric analysis (DEA) (1)
- Differenzierung (1)
- Dimethacrylate (1)
- Diodes (1)
- Diselenide bridge (1)
- Docking (1)
- Draw ratio (1)
- Drug target (1)
- Duroplast (1)
- Dynamic mechanical analysis (1)
- Dystonia (1)
- E-cadherin (1)
- E. coli (1)
- EIF-5A (1)
- EPS (1)
- ER stress (1)
- ERO1α (1)
- ESKAPEE pathogens (1)
- Echtzeitüberwachung (1)
- Ectodomain shedding (1)
- Effect of post-irradiation curing (1)
- Einführung (1)
- Electrochemical cells (1)
- Electron beam physical vapor deposition (1)
- Elephantiasis (1)
- Elution (1)
- Enantioselective gas chromatography (1)
- Endoplasmatic reticulum (1)
- Endosomes (1)
- Endothelial cells (1)
- Endothelin-1 (1)
- Engineering (1)
- Engineering plastics (1)
- Enzyme activity assays (1)
- Epilepsy (1)
- Epitope mapping: Epitope extraction (1)
- Ernte (1)
- European horse chestnut (1)
- Eutectic Ti-Fe alloys (1)
- Evaluation of curing (1)
- ExoMars (1)
- Expanded polystyrene (EPS) (1)
- Explosivstoff (1)
- Extrusionsblasformen (1)
- FOXP3 (1)
- FRAP (1)
- FTIR (1)
- Fabry disease (1)
- Fachrechnen (1)
- Familial glioma (1)
- Fatigue crack growth (1)
- Fe-ion radiation (1)
- Fertigation (1)
- Festigkeitslehre (1)
- Festschrift (1)
- Fiber reinforcement (1)
- Fiber-optic probe (1)
- Fibroblast-like synoviocytes (FLS) (1)
- Filler content (1)
- Fingerprint powder (1)
- Flow direction (1)
- Fluorescence-quenched substrates (1)
- Foaming (1)
- Folin-Ciocalteu (1)
- Folin–Ciocalteu assay (1)
- Food intolerance (1)
- Food packaging (1)
- Food security (1)
- Forensic genetics (1)
- Forensic genomics (1)
- Forschung (1)
- Fourier-transform infrared spectroscopy (1)
- Frequenzauswertung (1)
- Fructose (1)
- Furnace pyrolyzer (1)
- Fährverkehr (1)
- GC (1)
- GC-FID (1)
- GC–MS (1)
- GC–MSgas chromatography–mass spectrometry (1)
- GFRP (1)
- GMX1778 (1)
- Galactic Cosmic Rays (GCRs) (1)
- Gas Chromatography (1)
- Gas chromatography-mass spectrometry (1)
- Gas chromatography/ mass spectrometry (1)
- Gas chromatography/mass spectrometry (GC/MS) (1)
- Gas chromatography–mass spectrometry (1)
- Gas sensors (1)
- Gas turbines (1)
- Gasanalyse (1)
- Gaschromatographie (1)
- Gasturbinenschaufel (1)
- Gelatin Zymography (1)
- Gene Expression Regulation (1)
- Genes (1)
- Genotoxicity (1)
- Genotyp (1)
- Geopolymer (1)
- Geruchssinn (1)
- Ghanaian children (1)
- Glutamin N-phenylacetyltransferase (1)
- Glutathione (1)
- Glutathione synthetase (1)
- Glycerate (1)
- Glyceric aciduria (1)
- Glycin N-acyltransferase (1)
- Glycine N-Acyltransferase (GLYAT) (1)
- Glycogen storage disease type (1)
- Glycopeptides (1)
- Glyzinkonjugation (1)
- Graft material (1)
- Green fluorescent protein (1)
- Growth (1)
- HPLC Optimierung (1)
- HPTLC (1)
- HPV diagnostic (1)
- HS SPME (1)
- HS SPME–GC/MS (1)
- HSD10 (1)
- HSP90 (1)
- Hands-On Learning/Manipulatives (1)
- Hard tissue (1)
- Hardness mapping (1)
- Harnstoffzyklusdefekt (1)
- Hazardous material detection (1)
- Headspace SPME (1)
- Health care policy (1)
- Heparanase (1)
- Heparin (1)
- Heterogenes Sensorsystem (1)
- Hexamethylene triperoxide diamine (HMTD) (1)
- High performance liquid chromatography (1)
- High performance liquid chromatography – mass-spectrometry (HPLC-MS/MS) (1)
- High speed tensile testing (1)
- High strain rate (1)
- High temperature deformation (1)
- High temperature laser powder bed fusion (1)
- Hochschule (1)
- Hochschule Bonn-Rhein-Sieg (1)
- Home made explosives (1)
- Homemade explosives (1)
- Homeobox (1)
- Horner-Wadsworth-Emmons olefination Irreversible inhibition (1)
- Hydraulic cylinders (1)
- Hyperalgesia (1)
- Hyperammonemia (1)
- Hypoglycemia (1)
- Hypusine (1)
- ICP OES (1)
- IED (1)
- IR-microspectroscopy (1)
- IRE1 (1)
- Identification (1)
- Illegal Wildlife Trade (1)
- Immune escape (1)
- Immunoadsorption (1)
- Immunology* (1)
- Impedance spectroscopy (1)
- Improvised explosive devices (1)
- In silico epitope prediction (1)
- In silico modelling (1)
- Inborn errors of metabolism (1)
- Indentation techniques (1)
- Individualisierte Medizin (1)
- Industrial applications (1)
- Infrared (1)
- Infrarot (1)
- Infrarotmikroskopie (1)
- Inherited metabolic disorders (1)
- Inhibitor (1)
- Innovation (1)
- Instrumental analysis (1)
- Instrumentation (1)
- Insulin glulisine (1)
- Intact proinsulin (1)
- Interface (1)
- Introduction (1)
- Ion mobility (1)
- Ionenbeweglichkeitsspektroskopie (1)
- Ionic liquids (1)
- Ionizing radiation (1)
- Irradiance Distribution (1)
- Irradiance distribution (1)
- Isoleucine (1)
- Isoleucine degradation (1)
- Isomers (1)
- Isotherms (1)
- Isovalerianazidämie (1)
- Joint Destruction (1)
- Juvenile arthritis (JA) (1)
- K/BxN mouse model (1)
- K/B×N model (1)
- Kardioprotektion (1)
- Karl Fischer titration (1)
- Ketoasidoz (1)
- Ketogenic diet (1)
- Ketone body synthesis (1)
- Knochenersatz (1)
- Knochenzement (1)
- Knoop micro-hardness (1)
- Koagulation (1)
- Koaxiales Elektrospinnen (1)
- Kozak-sequence (1)
- Kraft lignin (1)
- Kriechen (1)
- Kriminaltechnik (1)
- Kunststoffverpackung (1)
- LC-HRMS (1)
- LC-MS/MS (1)
- LET (1)
- LFA-1 (1)
- LSPR (1)
- Laboratories and Demonstrations (1)
- Lamellae structure (1)
- Lanthanide luminescence (1)
- Laser drilling (1)
- Laser induced breakdown spectroscopy (1)
- Laser-Beam Profiler (1)
- Laserbohren (1)
- Lasermaterialbearbeitung (1)
- Lebensdauervorhersage (1)
- Lebensmittelverpackungen (1)
- Leg (1)
- LeuT (1)
- Leucine (1)
- Leucine degradation (1)
- Lexikon (1)
- Libido-booster (1)
- Ligand -Receptor Interactions* (1)
- Light Curing Units (1)
- Light attenuation (1)
- Light curing (1)
- Light curing units (1)
- Light limitation (1)
- Light measurement (1)
- Lignin-based composites (1)
- Linear viscoelasticity (1)
- Lineare Viskoelastizität (1)
- Linezolid (1)
- Lipoaspirate (1)
- Lipoaspirates (1)
- Liquid crystal (1)
- Liquid-liquid extraction (LLE) (1)
- Lithium (1)
- Local mechanical properties (1)
- Local process-dependent properties (1)
- Locomotion (1)
- Long-chain N-1-alkyl-1,3-propanediamines (1)
- Low-input crops (1)
- Luftfracht (1)
- Lymphedema (1)
- Lysosome (1)
- Lysosomes (1)
- MADDMultiple acyl-CoA dehydrogenase deficiency (1)
- MALDI QIT TOF MS (1)
- MAP (1)
- MAPO (1)
- MCT (1)
- MICA/B (1)
- MMP-9 (1)
- MOCS1 (1)
- MOX Gassensoren (1)
- MOX gas sensors (1)
- MPV17 monoclonal antibody (1)
- MRPP (1)
- MS (1)
- MS/MS peptide sequencing (1)
- MSCs (1)
- Machine learning (1)
- Macrophage (1)
- Macrophage migration inhibitory factor (1)
- Macrophages (1)
- Magnetic resonance imaging (MRI) (1)
- Mal d 1 (1)
- Malus domestica (1)
- Malus genotypes (1)
- Mapping (1)
- Mars environment (1)
- Mars exploration (1)
- Mass Spectrometry (1)
- Mass transport (1)
- Mast cells (1)
- Materialverarbeitung (1)
- Matrix metalloproteases (1)
- Meat-associated Microorganisms (1)
- Mechanical properties of materials (1)
- Mechanische Prüfung (1)
- Mehrachsigkeit (1)
- Mesenchymal Stromal Cells/cytology (1)
- Mesenchymal stromal cells (1)
- Metabolicdecompensation (1)
- Metal oxide gas sensors (1)
- Metals (1)
- Method validation (1)
- Methylation (1)
- Methyltransferase (1)
- Michael acceptors (1)
- Micro-mechanical properties (1)
- Microcirculation (1)
- Microindentation (1)
- Micromanipulation (1)
- Microplastics (1)
- Miscanthus nagara (1)
- Miscanthus robustus (1)
- Miscanthus sinensis (1)
- Mitochondria (1)
- Mitochondrial DNA depletion syndrome (1)
- Mitochondrial apoptogens (1)
- Mitochondrial outer membrane permeabilization (MOMP) (1)
- Mitochondrial tRNA (1)
- Mobile explosive identification (1)
- Moco deficiency (1)
- Mold temperature (1)
- Molecular Dynamics (1)
- Molecular weight (1)
- Molekulargewicht (1)
- Molybdenum cofactor (1)
- Monocarboxylate transporter 1 (1)
- Motion tracking (1)
- Motivation (1)
- Movement disorder (1)
- Multi-lineage differentiation (1)
- Multilineage potential (1)
- Multimodal hyperspectral data (1)
- Multivariate analysis (1)
- N-acetylaspartic acid (1)
- N-acylated amino acids (1)
- N-isovalerylglycine (1)
- NAI (1)
- NDVI (1)
- NGS (1)
- NKG2D (1)
- NMR-Spektroskopie (1)
- NSS family (1)
- Nachhaltigkeit (1)
- Nachwachsender Rohstoff (1)
- Nadelhölzer (1)
- Nafion™ (1)
- Nano-systems (1)
- Nanofibers (1)
- Nanoparticles (1)
- Native mass spectrometry (1)
- Naturkautschuk (1)
- Near-field synchrotron ptychographic X-ray computed tomography (1)
- Neugeborenenscreening (1)
- Neurometabolic disease (1)
- Neuropilin (1)
- Neuroprotective (1)
- Next Generation Sequencing (NGS) (1)
- Next generation sequencing (1)
- Next generation sequencing (NGS) (1)
- Nickel-based superalloy (1)
- Nickelbasis-Superlegierung (1)
- Nitriles (1)
- Nitrogruppe (1)
- Node involvement (1)
- Non-covalent interaction MS* (1)
- Non-destructive (1)
- Nonketotic hyperglycinemia (1)
- Nonlinear coefficient (1)
- O3/UV (1)
- OA, organic acids (1)
- OH-Zahl-Bestimmungen (1)
- OH-number (1)
- OXCT1 (1)
- Oak leaf poisoning (1)
- Off-target effects (1)
- Oligodendroglioma (1)
- Optical sensor (1)
- Optische Gassensorik (1)
- Orai1 (1)
- Organische Säuren (1)
- Organosolv (1)
- Organosolv process (1)
- Organosolv-Lignin (1)
- Organosolv-Verfahren (1)
- Orientation averaging (1)
- Orion (1)
- Osteogene Linie (1)
- Osteogenic differentiation (1)
- Osteogenic lineage (1)
- Ovarian cancer (1)
- Oxazolidinone antibiotics (1)
- P1 receptor (1)
- P2 receptor (1)
- P4 medicine (1)
- PCR inhibitors (1)
- PD-1/CTLA-4 (1)
- PDI (1)
- PEM electrolysis (1)
- PERK (1)
- PLASM (1)
- PLS-regression (1)
- PTHrP (1)
- PTR-MS (1)
- PTR-ToF (1)
- Packaging (1)
- Partial least squares regression (1)
- Partikeltechnologie (1)
- Partikelverarbeitung (1)
- Pathogenic Bacteria (1)
- Pattern recognition (1)
- Patterning (1)
- Paulownia (1)
- Paulownia tomemtosa (1)
- Peptidomimetic inhibitors (1)
- Permeation (1)
- Peroxisomes (1)
- Pervanadate (1)
- Pharmacogenetics (1)
- Phase II Reaktion (1)
- Phase II reaction (1)
- Phenol-Formaldehyd-Harze (1)
- Phenole-formaldehyde resin (1)
- Phenolic acids (1)
- Phenylacetyl-coenzym A (1)
- Phenyls (1)
- Photoinitiator (1)
- Photopolymerization (1)
- Phycocyanin lyase (1)
- Physical sensors (1)
- Physiological stress responses in plants (1)
- Picea abies (1)
- Picea pungens (1)
- Plasmid DNA (pBR322) (1)
- Pleiotropic drug resistance (1)
- Poly(acrylonitrile-co-1,3-butadiene-co-styrene)/polyamide 6 (ABS/PA 6) blends (1)
- Polymer Chemistry (1)
- Polymere (1)
- Polymers/copolymers (1)
- Polysaccharide derivatives (1)
- Polyurethan (1)
- Polyurethan-Coatings (1)
- Polyurethanbeschichtungen (1)
- Polyurethane (1)
- Portland cement (1)
- Post-prandial metabolism (1)
- Poultry (1)
- Poultry meat (1)
- Poultry spoilage (1)
- Pregnancy (1)
- Pressure-sensitive adhesive (1)
- Primary explosives (1)
- Principal component analysis (1)
- Probabilistic methods (1)
- Probenahme (1)
- Programmed cell death (1)
- Proliferation (1)
- Promoter methylation (1)
- Propellants (1)
- Prostate cancer (1)
- Proteasome (1)
- Proteasome maturation (1)
- Protected cultivation (1)
- Protein complex analysis (1)
- Protein-protein interaction (1)
- Proton-Transfer-Reaction Mass Spectrometry (1)
- Prunus avium L. (1)
- Präkeramische Papiere (1)
- Prüfungsvorbereitung (1)
- Ps. fluorescens (1)
- Pulping (1)
- Purinergic signaling (1)
- Py-GC/MS (1)
- Py-MS (1)
- Pyrogallol (1)
- Pyroglutamic aciduria (1)
- Pyrolyse-GC/MS (1)
- Pyrolysis GC/MS (1)
- Pyrolysis mass spectrometry (PyMS) (1)
- Pyrolysis-GC/FID (1)
- Pyrolysis-GC/MS (1)
- Pyrolysis-evolved gas analysis-mass spectrometry (1)
- Pyrolysis–GC/MS (1)
- Qualitative Analysis (1)
- Qualitative analysis (1)
- Quantification (1)
- Quasi equilibrium conditions (1)
- R751L (1)
- Radiation (1)
- Raman (1)
- Raman Spectroscopy (1)
- Raman and FTIR spectroscopies (1)
- Raman-Spektroskopie (1)
- Rapeseed pomace (1)
- Rapid method (1)
- Real-time measurement (1)
- Receptors, Purinergic P2 (1)
- Receptors, Purinergic/genetics/physiology (1)
- Redox potential (1)
- Regeneration (1)
- Research reproducibility and replicability (1)
- Resin based composite (1)
- Resin composite (1)
- Resin-based composites (1)
- Resource Planning (1)
- Ressource (1)
- Restorative composite (1)
- Reversible inhibition (1)
- RheoTack analysis (1)
- Rheologie (1)
- Rheology (1)
- Rheometer (1)
- Rosskastanie (1)
- Rubbers (1)
- S-sulfocysteine (1)
- SAM486A (1)
- SARS-COV-2 virus (1)
- SAXS (1)
- SCNN1D (1)
- SEC (1)
- SGN-35 (1)
- SHAP (1)
- SLC6 (1)
- SLC6A14 (1)
- SMBG (1)
- SNPSTR (1)
- SOS-LC (1)
- SOS-LUX test (1)
- SPME (1)
- STARLIFE project (1)
- STF-31 (1)
- Saccharomyces cerevisiae (1)
- Safety and security (1)
- Sample digestion (1)
- Saponin (1)
- Scanning electron microscopy (SEM) (1)
- Schadensanalyse (1)
- Schmauchspur (1)
- Schneeglöckchen (1)
- Schusswaffe (1)
- Schwindung (1)
- Sclera (1)
- Second-Year Undergraduate (1)
- Secondary compounds in plants (1)
- Secondary metabolism (1)
- Selektives Screening (1)
- Selenocysteine (1)
- Self-assembling (1)
- Sensors (1)
- Serine (1)
- Serine proteases (1)
- Sexual assault (1)
- Shear thickening (1)
- Shear viscosity (1)
- Sicherheitsmaßnahme (1)
- Silica gel (1)
- Silica-based nanobeads (1)
- Silicon Carbides (1)
- Silphium (1)
- Silphium perfoliatum (1)
- Simulated sunlight (1)
- Sinapine (1)
- Single Lens Reflex Camera (1)
- Single sperm cells (1)
- Skin (1)
- Skin cells (1)
- Skin flakes (1)
- Soluble CD21 (1)
- Soluble CD23 (1)
- Solution chemistry (1)
- Space (1)
- Space radiation (1)
- Spectroscropy (1)
- Sperm cells (1)
- Spermatozoa (1)
- Splicing (1)
- Spoilage (1)
- Spoilage bacteria (1)
- Sports doping (1)
- Sprengstoffspürhund (1)
- Sprouting (1)
- Spürhund (1)
- Stabilisator (1)
- Stabilization (1)
- Stabilizer (1)
- Stammzelle (1)
- Static stiffness (1)
- Statik (1)
- Statistical methods (1)
- Steinzeug (1)
- Stem cell (1)
- Stem cell differentiation (1)
- Stereoisomers (1)
- Stiffness (1)
- Storage modulus (1)
- Store-operated calcium entry (1)
- Strain stiffening (1)
- Stress analysis (1)
- Stress strain relation (1)
- Strukturaufklärung (1)
- Studienfach (1)
- Study Island (1)
- Stöchiometrie (1)
- Substrate mapping (1)
- Substrate specificity (1)
- Sulfite oxidase (1)
- Sulfonamides (1)
- Superconductivity (1)
- Supervised classification (1)
- Support vector machines (1)
- Surfaces, interfaces and thin films (1)
- Surveillance (1)
- Survey (1)
- Suspension (1)
- Sympathetic reflexes (1)
- Synergie (1)
- Synovial fluid (1)
- Synthesis (1)
- Systemic lupus erythomatosus (SLE) (1)
- TATP (1)
- TGA-FTIR (1)
- TGA-MS (1)
- TOF (1)
- Tandem-Massenspektrometrie (1)
- Tap water (1)
- Targeted mass spectrometry (1)
- Technische Chemie (1)
- Telemedicine (1)
- Telogen hair (1)
- Temperaturgradienten (1)
- Template-mediation (1)
- Terbium(III) dipicolinic acid complex (1)
- Tetramerisation (1)
- Therapeutic antibodies* (1)
- Thermal barrier coating (1)
- Thermal conductivity (1)
- Thermal expansion (1)
- Thermochemical conversion (1)
- Thermodynamics (1)
- Thermoplastic polyurethanes (1)
- Thermormechanical fatigue/cycling (1)
- Thermoschockverhalten (1)
- Thiol antioxidants (1)
- TiO2-coatings (1)
- Time dependency (1)
- Time–kill methodology (1)
- Tinten (1)
- Tissue-specific promoters (1)
- Total phenol content (1)
- Transcription Regulation (1)
- Transcriptional targeting (1)
- Transdermal therapeutic system (1)
- Transformation products (1)
- Transgenic mice (1)
- Trapped radicals (1)
- Treatment (1)
- Truncated dhs (1)
- Type 2 diabetes (1)
- UPR signaling (1)
- UV Absorption (1)
- UV absorbance (1)
- UV spectrum (1)
- UV-Absorption (1)
- UV-VIS (1)
- UV-vis spectroscopy (1)
- Ultimate coefficient of thermal expansion (1)
- Ultrafine microstructures (1)
- Ultrasonic studies (1)
- Unconjugated THC-COOH (1)
- Urea cycle defect (1)
- Urinary bladder (1)
- Urinary organic acids (1)
- Urine organic acid analysis (1)
- Urothione (1)
- Used engine oil (1)
- VOCs (1)
- Valproic acid (1)
- Vascular Smooth Muscle Cells (1)
- Vascular cells (1)
- Vascular grafts (1)
- Vascular permeability (1)
- Vasculature (1)
- Verzug (1)
- Vibrational microspectroscopy (1)
- Vickers hardness (1)
- Vim3 (1)
- Visceral afferents (1)
- Visceral lipid tissue (1)
- Visceral pain (1)
- Viscoelastic behavior (1)
- Visible light curing (1)
- Visible light curing resin (1)
- Visible light-curing (1)
- Vitamin A acetate isomers (1)
- Volatile organic compounds (1)
- Vulkanisation (1)
- WAXS (1)
- WZB117 (1)
- Wasserverteilung (1)
- Weihnachtsbaum (1)
- Werkstoffmodellierung (1)
- Western blot (1)
- Whole genome amplification (WGA) (1)
- Whole-genome sequencing (1)
- Wild Type Mouse (1)
- Wildlife Forensics (1)
- Wireless sensor network (1)
- Wirkstofffreisetzung (1)
- Wnt/β-catenin (1)
- Wolframin (1)
- Wärmedämmschicht (1)
- X Thermal barrier coating (1)
- X-STR (1)
- X-ray photoelectron spectroscopy (1)
- X-ray powder diffraction (XRD) (1)
- XBP1 (1)
- XGBoost (1)
- XRD (1)
- Y-STR (1)
- Yeast (1)
- Yield stress (1)
- Young’s modulus (1)
- Zahnfollikel (1)
- Zahnfüllung (1)
- Zytokin-induzierte Killerzellen (1)
- accelerated iron ions (1)
- accurate monitoring (1)
- acetoacetic acid (1)
- acetone (1)
- acidic ethanosolv (1)
- actin (1)
- actinometry (1)
- adhesion factor (1)
- adoptive cell transfer (1)
- adverse effects (1)
- aerogels (1)
- agarose (1)
- aircraft engine part (1)
- albuminuria (1)
- alkaline phosphatase (1)
- alkyl amines (1)
- allergenicity (1)
- allosteric communication (1)
- altered mitochondrial homeostasis (1)
- amelogenesis (1)
- amino acid transporter (1)
- amodiaquine (1)
- amorphous 2D polymer (1)
- amplicon sequencing (1)
- anabolic (1)
- anaplastic lymphoma kinase (1)
- angiodiabetes (1)
- anorganische Schmauchspur (1)
- antibacterial (1)
- antibiotic prophylaxis (1)
- antibody–drug conjugate (1)
- antifungal (1)
- antimicrobial (1)
- antimicrobial coatings (1)
- antimikrobielle Beschichtungen (1)
- antioxidative capacity (1)
- antiradical activity (1)
- apple allergy (1)
- apple replant disease (ARD) (1)
- arthritis (1)
- ash (1)
- astrobiology (1)
- atmosphere (1)
- autohydrolysis (1)
- autoimmune disease (1)
- autologous bone graft (1)
- automated electrophysiology (1)
- automated sensor-screening (1)
- automatic measurement validation (1)
- automation of sample processing (1)
- automotive paint (1)
- automotive lever (1)
- autophagy signaling pathways (1)
- bagasse (1)
- basalt (1)
- bdelloid rotifer (1)
- benchtop (1)
- benzoyl-coA (1)
- beta-ketothiolase (1)
- bio-based (1)
- bio-chemicals (1)
- bio-innovation (1)
- bioactive factors (1)
- biobased plastics (1)
- biobasiert (1)
- biobasierte Kunststoffe (1)
- biochemical fingerprinting (1)
- biochemistry (1)
- biocomposite (1)
- biodegradable (1)
- bioenergy (1)
- biofilm removal (1)
- biofilm-related infections (1)
- bioinformatics (1)
- biomarker (1)
- biomarker profile (1)
- biomaterials (1)
- biomolecules (1)
- biopolymer (1)
- biopolymers (1)
- biorefineries (1)
- bio‐based (1)
- black fungi (1)
- blebbistatin (1)
- blood glucose meters (1)
- blood glucose monitoring device (1)
- blood vessel (1)
- blow molding (1)
- blown film (1)
- bone mineral density (1)
- bone remodeling (1)
- brain tumor (1)
- branched-chain amino acids (1)
- breast carcinoma (1)
- brightfield microscopy (1)
- brilliant green (1)
- built environment (1)
- bulk and local viscoelastic properties (1)
- bypass graft (1)
- cPMP (1)
- cabbage waste (1)
- calendering (1)
- cancer (1)
- cancer biomarker (1)
- cancer treatment (1)
- cannabidiol, immunotherapy (1)
- cardiodiabetes (1)
- cardiovascular replacement (1)
- cartilage (1)
- caspase (1)
- caspases (1)
- catabolic (1)
- catalysis (1)
- cell division (1)
- cell harvesting (1)
- cell viability (1)
- cellulose saccharification (1)
- cementogenesis (1)
- ceramic (1)
- ceramics (1)
- chaetocin (1)
- chain extender cross-linker (1)
- chain extenders cross-linker (1)
- chain extending cross-linker (1)
- chain-extending cross-linker (1)
- characterization (1)
- chemical pathology (1)
- chemosensing (1)
- chiral-nematic (1)
- chitosan (1)
- cholesteric liquid crystals (1)
- cholesteric phase (1)
- chromanones (1)
- chromatogram library (1)
- ciclopirox olamine (1)
- clear cell renal cell carcinoma (1)
- clear coat (1)
- clinical trials (1)
- coagulation (1)
- coaxial electrospinning (1)
- coefficient of thermal expansion (1)
- coffee ring effect (1)
- collagen (1)
- combination (1)
- combination of treatments (1)
- common variable immunodeficiency (1)
- components (1)
- composite materials (1)
- composites (1)
- compost disintegration (1)
- condensation (1)
- conditioned media (1)
- confocal fluorescence microscopy (1)
- contribution ratio (1)
- copolymers of methacrylic acid with poly(ethylene glycol) methyl ether methacrylate macromonomers (1)
- core-sheath fibers (1)
- cosmic rays (1)
- cost optimization (1)
- cracks (1)
- creep compliance (1)
- cross-linking (1)
- crystal violet (1)
- crystallinity (1)
- cube in cube model (1)
- curing behavior (1)
- cysticfibrosis (1)
- cytoskeleton (1)
- data base search (1)
- data evaluation (1)
- decay classes (1)
- defects (1)
- deformation behavior (1)
- degraded DNA (1)
- degree of disintegration (1)
- delta-subunit (1)
- demethylation (1)
- dental implant (1)
- dental polymers (1)
- dental stem cells (1)
- dental stem cells immortalization (1)
- dentinogenesis (1)
- dentogenesis (1)
- dependability analysis (1)
- depolymerization (1)
- desert cyanobacteria (1)
- designer drugs (1)
- detaching (1)
- determination of OH content (1)
- diabetes mellitus (1)
- diabetic dyslipidemia (1)
- diagnosis and management (1)
- dielectric analysis (DEA) (1)
- dielektrická analýza (1)
- differential scanning calorimetry (DSC) (1)
- disintegration kinetics (1)
- dissolved ozone (1)
- distribuce záření (1)
- distributed embedded computing system (1)
- draw ratio (1)
- drug delivery (1)
- drug detection (1)
- drug release materials (1)
- duty ratio (1)
- dyes (1)
- dynamic mechanic analysis (DMA) (1)
- eIF-5A (1)
- electroless copper deposition (1)
- electroretinography (1)
- electrospinning (1)
- elementary volume (1)
- encapsulation (1)
- endocytosis (1)
- endometrial carcinoma (1)
- endoplasmic reticulum (ER) stress (1)
- endoplasmic reticulum stress (1)
- endothelial cell (1)
- endothelial cell differentiation (1)
- endothelial cells (1)
- energy deposition (1)
- energy dispersive X-ray diffraction (1)
- engineering plastics (1)
- enzyme activity (1)
- epithelial sodium channel (1)
- epithelial transport (1)
- epitope mapping (1)
- ethacrynic acid (1)
- exon fusion (1)
- explosives (1)
- explosives detection (1)
- extra column band broadening (1)
- extraction-linked bias (1)
- failure analysis (1)
- fasentin (1)
- fatty acid metabolism (1)
- feature (1)
- fiber composites (1)
- fish gill (1)
- flow cytometry (1)
- flow direction (1)
- fluorinated salts (1)
- food contact material (1)
- food safety (1)
- force-retraction displacement-curve (1)
- forensic (1)
- forensic genetics (1)
- formulation (1)
- fotokompozit (1)
- fractional activity (1)
- fungal and bacterial amplicon sequencing (1)
- gas turbine blade (1)
- gene expression (1)
- generative manufacturing (1)
- genetic polymorphism (1)
- genomic data (1)
- genotype (1)
- geopolymer (1)
- geopolymer foam (1)
- glass fibers (1)
- glucocheck (1)
- glucose uptake inhibitor (1)
- glutamine N-phenylacetyltransferase (1)
- glycemic control (1)
- glycerol (1)
- greenhouse bio-test (1)
- growth factors (1)
- growth hormone (1)
- guidelines (1)
- habitability (1)
- halogen bonding (1)
- hard and soft tissue (1)
- hardness testing (1)
- harvest prediction (1)
- healthcare-associated infections (HAI) (1)
- heart protection (1)
- heat shock proteins (1)
- heat shock response (1)
- heat-transfer method (1)
- heavy ion particle (HZE) radations (1)
- helical drilling (1)
- helical twisting power (1)
- hepatocellular carcinoma (1)
- heterocyclic (1)
- heterozygous ALPL mutation (1)
- high diagnostic coverage and reliability (1)
- high dynamic range resistance readout (1)
- high-performance liquid chromatography (1)
- high-sensitivity C-reactive protein (hsCRP) (1)
- high-throughput DNA sequencing (1)
- high-throughput qRT-PCR (1)
- high-throughput sequencing (1)
- histamine receptor (1)
- histamine receptor antagonist (1)
- histidine decarboxylase (1)
- histone deacetylase inhibitors (1)
- homemade explosives (1)
- homeostatic model assessment (HOMA) (1)
- horse chestnut (1)
- hospital environment (1)
- hospital-acquired infections (1)
- human cholinesterases (1)
- human microbiome (1)
- hydrogen bonding (1)
- hydroxyapatite (1)
- hydroxypropylmethylcellulose (1)
- hyperammonemia (1)
- hypertension (1)
- hypogammaglobulinemia (1)
- hypoglycemia (1)
- hypophosphatasia (1)
- hypoxia (1)
- iPS cells (1)
- iPSCs (1)
- iPad (1)
- immune checkpoint inhibition programmed cell death-1 (1)
- immunhistochemistry (1)
- immunology (1)
- impact monitoring (1)
- impact sensitivity (1)
- impedance spectroscopy (1)
- impregnation-reduction (1)
- increments of retention indices (1)
- individualized therapy (1)
- infection prevention (1)
- infectious disease (1)
- inherited metabolic disease (1)
- inorganic pyrophosphate (1)
- intact proinsulin (1)
- integrative Simulation (1)
- integrative simulation (1)
- interferon γ (1)
- internal drug exposure (1)
- intrinsic pathway (1)
- invasion (1)
- ion viscosity (1)
- ionic polymer metal (1)
- isoleucine metabolism (1)
- isothermal (1)
- ketogenesis defects (1)
- ketogenez defektleri (1)
- ketoliz defektleri (1)
- ketolysis defects (1)
- keton bodies (1)
- ketone body synthesis (1)
- kinetika vytvrzování (1)
- klarzelliges Nierenzellkarzinom (1)
- layer-by-layer encapsulation (1)
- leishmaniasis (1)
- leucine degradation (1)
- life on Mars (1)
- life-detection (1)
- light distribution (1)
- lignin structure analysis (1)
- lignocellulose chemistry (1)
- lignocellulosic feedstock (1)
- lignocellulosic raw material (1)
- lignosulfonate (1)
- liquid chromatography (1)
- liquid crystal (1)
- liquid crystals (1)
- long interspersed nuclear element-1 (1)
- long-term storage (1)
- low detection limits (1)
- low molecular weight (1)
- low-level laser therapy (1)
- lung cancer (1)
- lymphoma (1)
- mTOR (1)
- major histocompatibility complex class I polypeptide-related sequence A (MICA) (1)
- massive parallel sequencing (1)
- material modelling (1)
- materials processing (1)
- maturity index (1)
- mechanical testing (1)
- mechanical thinning (1)
- melt fraction (1)
- melt interconnection (1)
- member D (NKG2D) (1)
- mesenchymal stem cell (1)
- mesogens (1)
- metabolic effects (1)
- metabolically active cells (1)
- metal nanoparticles (1)
- methylmalonic acidaemia (1)
- methylmalonic acidemia (1)
- miR-15 (1)
- miR-498 (1)
- micro processing (1)
- microbial community structure (1)
- microbial contamination (1)
- microbial ecology (1)
- microbiome (1)
- microbiome analyses (1)
- microdialysis (1)
- microindentation (1)
- micromanipulation (1)
- mitochondrial biogenesis (1)
- mixed-mode chromatography (1)
- mobile Explosivstoffdetektion (1)
- modelling (1)
- mold temperature (1)
- molecular docking (1)
- molecular dynamics (1)
- molecular dynamics simulations (1)
- molecular mass degradation (1)
- molecular motor (1)
- molecular pathology (1)
- molecular weight (1)
- molecular weight determination (1)
- molecule-surface interactions (1)
- monoamine oxidases (1)
- monoclonal antibody (1)
- multi-drug response (1)
- multiaxial stress state (1)
- multidimensional (1)
- multineurotarget agents (1)
- multiple myeloma (1)
- multiple myeloma (MM) (1)
- multiresolution analysis (1)
- multivariate data analysis (1)
- multivariate statistical analysis (1)
- multivariate statistics (1)
- mutations (1)
- myogenesis (1)
- nachhaltig (1)
- nano structured gas sensors (1)
- nanobodies (1)
- nanocrystalline diamond (1)
- nanomaterials (1)
- nanomedicine (1)
- nanostructured surfaces (1)
- natural fiber (1)
- natural killer group 2 (1)
- neoexpression (1)
- neuroendocrine (1)
- next generation sequencing (1)
- nitrogen dioxide (1)
- non-HDL-C and Cardiovascular disease (1)
- non-apoptotic roles (1)
- non-small cell lung cancer (1)
- non-woven fiber mats (1)
- nondestructive examination (1)
- nosocomial infections (1)
- nucleic acids (1)
- nutrient germinants (1)
- nutrigenetics (1)
- nutrigenomics (1)
- odontogenic cells (1)
- organic acid analysis (1)
- organische Schmauchspur (1)
- organoids (1)
- organosolv lignin (1)
- orthotropes prozessabhängiges Materialverhalten (1)
- orthotropic process-dependent material behavior (1)
- osteogenic potential (1)
- osteoporosis (1)
- outer space (1)
- oxalic acid (1)
- p27 (1)
- p53 (1)
- paediatric clinical genetics & dysmorphology (1)
- paediatric endocrinology (1)
- paediatric intensive & critical care (1)
- panspermia (1)
- papier-abgeleitete Keramiken (1)
- papierabgeleitete Keramik (1)
- partial melting (1)
- partial squares regression (1)
- particle processing (1)
- particulate composite (1)
- patent (1)
- pathogen control (1)
- pathogenic microorganisms (1)
- pathophysiology (1)
- peptide sequencing (1)
- perpendicular (1)
- personalized medicine (1)
- pharmacokinetics (1)
- phase II reaction (1)
- phenylacetyl-coA (1)
- phenylketonuria (1)
- phosphoethanolamine (1)
- photo-curing of polymers (1)
- photo-polymerization (1)
- photocatalysis (1)
- photostabiliser (1)
- phytoalexins (1)
- pigments (1)
- planetary protection (1)
- poly(butylene adipate-co-terephthalate) (1)
- poly(ethylene glycol) methyl ether methacrylate macromonomers (1)
- polybutylene adipate terephthalate (1)
- polyelectrolytes (1)
- polylactic acid (1)
- polysaccharide (1)
- polytunnel (1)
- polyurethane coatings (1)
- porosity (1)
- porphyria (1)
- postmenopause (1)
- potentiometric sensors (1)
- power industry (1)
- power stroke (1)
- precision (1)
- pressure sensitive adhesive (1)
- primary airway epithelial cells (1)
- primäre Explosivstoffe (1)
- principal component analysis (1)
- prioritizable ranking (1)
- proanthocyanidins (1)
- probiotic cleaning (1)
- probiotic-based cleaning formulations (1)
- process parameters (1)
- process-induced morphology (1)
- process-induced structure (1)
- processing-structure-property relationship (1)
- project-specific cost profile (1)
- proliferation (1)
- propionic acidaemia (1)
- propionic acidemia (1)
- protected cultivation (1)
- protein microarray (1)
- proteomics (1)
- prototype apparatus (1)
- proximal tubule (1)
- präkeramisches Papier (1)
- pseudogene (1)
- purinergic receptor (1)
- purinergic receptors (1)
- pyridoxal phosphate (1)
- pyrolysis-GC (1)
- pyrolysis-gas chromatography/mass-spectrometry (1)
- pyroplastic deformation (1)
- pyroplastic index (1)
- pyroplastische Verformung (1)
- pyroplastischer Index (1)
- qNMR (1)
- qPCR (1)
- quantitative RP-HPLC-DAD (1)
- quantitative RT-PCR (1)
- radiation (1)
- radioresistance (1)
- rating method (1)
- real-time PCR (1)
- recurrent ketoacidotic episodes (1)
- redundancy (1)
- regenerative medicine (1)
- relative density (1)
- release kinetics (1)
- renal cancer (1)
- renal cell carcinoma (1)
- renal tubular cells (1)
- resin for 3D-printing (1)
- resistance (1)
- ressources (1)
- restenosis (1)
- retinal degeneration (1)
- retraction speed dependency (1)
- rheumatoid arthritis (1)
- ring-size statistics (1)
- ripening (1)
- rodent (1)
- rodents (1)
- rosiglitazone (1)
- rubbers (1)
- sCD21 (1)
- safety measures (1)
- scanning tunnelling microscopy (1)
- scratch assay (1)
- screening (1)
- seed coat (1)
- selectivity tuning (1)
- self-assembled monolayers (1)
- self-monitoring BG (1)
- semiconducting metal oxide gas sensor array (1)
- semiconductors (1)
- sensitize (1)
- sensor array (1)
- sensory characterisation (1)
- sequencing (1)
- sexual assault (1)
- short tandem repeat (1)
- short tandem repeat (STR) (1)
- short-range correlation (1)
- shrinkage (1)
- single-domain antibody (1)
- single-nucleotide polymorphisms in DNA (1)
- sintering (1)
- sirtuins (1)
- size exclusion chromatography (1)
- skin cancer (1)
- slope based signature (1)
- smooth muscle cell (1)
- smooth muscle cell differentiation (1)
- snowdrop (1)
- sodium alginate (1)
- sodium self-inhibition (1)
- soil properties (1)
- soil sickness (1)
- sol-gel support (1)
- solute carrier (1)
- solvent exchange (1)
- space radiation environment (1)
- sperm cell (1)
- spore resistance (1)
- sporegermination (1)
- stabilisation (1)
- stabiliser (1)
- stationary phase (1)
- staurosporine (1)
- steady-state concentration (1)
- stem cell niche (1)
- stent (1)
- stoneware (1)
- stress analysis (1)
- structural biology (1)
- structural coloration (1)
- structure elucidation (1)
- structure prediction (1)
- substance aging (1)
- superalloys (1)
- supercritical drying (1)
- superficially porous particles (1)
- supramolecular liquid crystals (1)
- surface modification (1)
- surface sanitization (1)
- surfaces (1)
- surrogate endpoint (1)
- survival (1)
- sustainable (1)
- sweet cherry (Prunus avium L.) (1)
- sweet sorghum (1)
- switchgear station (1)
- synergism (1)
- synergistic effect (1)
- synthetic sapphire (1)
- system lay-out (1)
- system optimization (1)
- systemic response (1)
- tRNA processing (1)
- tack (1)
- temperature influence (1)
- templates (1)
- temporomandibular joint (1)
- therapy (1)
- thermal barrier coating (1)
- thermal gradient (1)
- thermal insulation material (1)
- thermal insulation materials (1)
- thermal shock behaviour (1)
- thermo-mechanical fatigue (1)
- thermochemical conversion (1)
- thermogravimetric analysis (1)
- thermomechanical fatigue/cycling (1)
- thermomechanische Ermüdung (1)
- thermophoresis (1)
- thermosensing (1)
- thin film (1)
- tiglyglycine (1)
- time series analysis (1)
- total phenolic content (1)
- transcriptional regulation (1)
- transient kinetics (1)
- transient receptor potential vanilloid Type 2 (1)
- triacetone triperoxide (1)
- triiodothyronine (1)
- triphenylmethane dyes (1)
- tumor diagnosis (1)
- tunable pitch (1)
- tunable sheet resistance (1)
- tungsten oxide (1)
- tvrdost (1)
- two-electrode voltage clamp (1)
- ultrashort pulse laser (1)
- unfolded protein response (1)
- unfolded protein response (UPR) (1)
- urea cycle defect (1)
- valine catabolic pathway (1)
- valine degradation (1)
- van Deemter curve (1)
- viscoelastic properties (1)
- visible light curing resin based composites (1)
- viskoelastické vlastnosti (1)
- volatile organic compound (VOC) sensing (1)
- volatile organic compounds (1)
- vytvrzování světlem (1)
- warpage (1)
- water-to-land transition (1)
- wearable technology (1)
- whole genome amplification (WGA) (1)
- whole-tooth regeneration (1)
- woody debris (1)
- wound healing assay (1)
- yield (1)
- yin-yang effect (1)
- zona pellucida protein 2 ZP2 (1)
- µCT (1)
- ß-OHB (1)
- ß-hydroxybutyrate (1)
- β-amino acids (1)
- β-catenin (1)
- β-catenin expression (1)
- β-cell dysfunction (1)
- β-cells (1)
- γ-glutamyl cycle (1)
- σ1 and σ2 receptors (1)
Our study shows ZP2 to be a new biomarker for diagnosis, best used in combination with other low abundant genes in colon cancer. Furthermore, ZP2 promotes cell proliferation via the ERK1/2-cyclinD1-signaling pathway. We demonstrate that ZP2 mRNA is expressed in a low-abundant manner with high specificity in subsets of cancer cell lines representing different cancer subtypes and also in a significant proportion of primary colon cancers. The potential benefit of ZP2 as a biomarker is discussed. In the second part of our study, the function of ZP2 in cancerogenesis has been analyzed. Since ZP2 shows an enhanced transcript level in colon cancer cells, siRNA experiments have been performed to verify the potential role of ZP2 in cell proliferation. Based on these data, ZP2 might serve as a new target molecule for cancer diagnosis and treatment in respective cancer types such as colon cancer.
Die Detektion von Explosivstoffen stellt ein zentrales Feld der zivilen Sicherheitsforschung dar. Eine besondere Herausforderung liegt hierbei in dem Nachweis verpackter Substanzen, wie es bei Unkonventionellen Spreng- und Brandvorrichtung (USBV) häufig der Fall ist. Derzeit eingesetzte Verfahren arbeiten meist mit bildgebenden Techniken, durch die sich ein Anfangsverdacht ergibt. Der tatsächliche chemische Inhalt der USBV lässt sich jedoch nicht exakt ermitteln. Eine genaue Beurteilung der Gefährdung durch solche Substanzen ist allerdings von großer Bedeutung, insbesondere wenn die Entschärfung des Objekts in bewohntem Gebiet stattfinden muss. In der vorliegenden Arbeit wird ein Verfahren vorgestellt, das sich als Verifikationsverfahren bei bestehendem Anfangsverdacht gezielt einsetzen lässt. Hierzu wird mittels Laserbohrtechnik zunächst die äußere Hülle des zu untersuchenden Gegenstandes durchdrungen. Anschließend finden eine lasergestützte Probenahme des Inhalts sowie die Detektion unter Verwendung geeigneter Analysemöglichkeiten statt. Der Bohr- und Probenahmefortschritt wird über verschiedene spektroskopische und sensorische Verfahren begleitend überwacht. Zukünftig soll das System abstandsfähig auf Entschärfungsrobotern eingesetzt werden.
Several species of (poly)saccharides and organic acids can be found often simultaneously in various biological matrices, e.g., fruits, plant materials, and biological fluids. The analysis of such matrices sometimes represents a challenging task. Using Aloe vera (A. vera) plant materials as an example, the performance of several spectroscopic methods (80 MHz benchtop NMR, NIR, ATR-FTIR and UV-Vis) for the simultaneous analysis of quality parameters of this plant material was compared. The determined parameters include (poly)saccharides such as aloverose, fructose and glucose as well as organic acids (malic, lactic, citric, isocitric, acetic, fumaric, benzoic and sorbic acids). 500 MHz NMR and high-performance liquid chromatography (HPLC) were used as the reference methods.
UV-VIS data can be used only for identification of added preservatives (benzoic and sorbic acids) and drying agent (maltodextrin) and semiquantitative analysis of malic acid. NIR and MIR spectroscopies combined with multivariate regression can deliver more informative overview of A. vera extracts being able to additionally quantify glucose, aloverose, citric, isocitric, malic, lactic acids and fructose. Low-field NMR measurements can be used for the quantification of aloverose, glucose, malic, lactic, acetic, and benzoic acids. The benchtop NMR method was successfully validated in terms of robustness, stability, precision, reproducibility and limit of detection (LOD) and quantification (LOQ), respectively.
All spectroscopic techniques are useful for the screening of (poly)saccharides and organic acids in plant extracts and should be applied according to its availability as well as information and confidence required for the specific analytical goal. Benchtop NMR spectroscopy seems to be the most feasible solution for quality control of A. vera products.
Ausführungsbeispiele schaffen eine Vorrichtung zur Desinfektion oder Sanitisierung zumindest eines Gegenstands. Die Vorrichtung umfasst einen Ozongenerator, der ausgebildet ist, um Ozon zu erzeugen und in einem Volumen freizusetzen. Ferner umfasst die Vorrichtung einen Ozonsensor, der ausgebildet ist, um eine Ozonkonzentration in dem Volumen zu messen. Ferner umfasst die Vorrichtung eine Steuereinrichtung, die konfiguriert ist, um den Ozongenerator anzusteuern Ozon zu erzeugen, so dass eine gemessene Ozonkonzentration für einen vorgegebenen Zeitraum bei einer vorgegebenen Ozonkonzentration oder innerhalb eines vorgegebenen Ozonkonzentrationsbereichs liegt, um in dem Volumen befindliche Gegenstände zu desinfizieren oder sanitisieren.
Once aberrantly activated, the Wnt/βcatenin pathway may result in uncontrolled proliferation and eventually cancer. Efforts to counter and inhibit this pathway are mainly directed against βcatenin, as it serves a role on the cytoplasm and the nucleus. In addition, speciallygenerated lymphocytes are recruited for the purpose of treating liver cancer. Peripheral blood mononuclear lymphocytes are expanded by the timely addition of interferon γ, interleukin (IL)1β, IL2 and anticluster of differentiation 3 antibody. The resulting cells are called cytokineinduced killer (CIK) cells. The present study utilised these cells and combine them with drugs inhibiting the Wnt pathway in order to examine whether this resulted in an improvement in the killing ability of CIK cells against liver cancer cells. Drugs including ethacrynic acid (EA) and ciclopirox olamine (CPX) were determined to be suitable candidates, as determined by previous studies. Drugs were administered on their own and combined with CIK cells and then a cell viability assay was performed. These results suggest that EAtreated cells demonstrated apoptosis and were significantly affected compared with untreated cells. Unlike EA, CPX killed normal and cancerous cells even at low concentrations. Subsequent to combining EA with CIK cells, the potency of killing was increased and a greater number of cells died, which proves a synergistic action. In summary, EA may be used as an antihepatocellular carcinoma drug, while CPX possesses a high toxicity to cancerous as well as to normal cells. It was proposed that EA should be integrated into present therapeutic methods for cancer.
Untersuchungen zur Hydrophobierung von Miscanthus X giganteus für den Einsatz in Dämmstoffsystemen
(2018)
Bisher ist nicht bekannt, in welchem Ausmaß Fremd- oder Störgerüche dazu geeignet sind, die allgemeine Leistungsfähigkeit eines Sprengstoffspürhundes einzuschränken oder sogar die Detektion eines Sprengkörpers zu verhindern. Ziel ist es zu untersuchen, inwieweit sich durch den gezielten Einsatz von Störsubstanzen die Sprengstoffdetektionsfähigkeit von Spürhunden beeinflussen lässt. Mit Detektionsfähigkeit ist hier sowohl die Wahrscheinlichkeit einer richtigen Detektion von Sprengstoffen in Gegenwart von starken Fremdgerüchen, als auch die ebenfalls zu erwartende Verringerung der Einsatzdauer (vorzeitige Erschöpfung) gemeint.
Untersuchungen zum Einfluss von chemischen Aktivatoren und Templaten auf die Zementhydratation
(2018)
The actomyosin system generates mechanical work with the execution of the power stroke, an ATP-driven, two-step rotational swing of the myosin-neck that occurs post ATP hydrolysis during the transition from weakly to strongly actin-bound myosin states concomitant with Pi release and prior to ADP dissociation. The activating role of actin on product release and force generation is well documented; however, the communication paths associated with weak-to-strong transitions are poorly characterized. With the aid of mutant analyses based on kinetic investigations and simulations, we identified the W-helix as an important hub coupling the structural changes of switch elements during ATP hydrolysis to temporally controlled interactions with actin that are passed to the central transducer and converter. Disturbing the W-helix/transducer pathway increased actin-activated ATP turnover and reduced motor performance as a consequence of prolonged duration of the strongly actin-attached states. Actin-triggered Pi release was accelerated, while ADP release considerably decelerated, both limiting maximum ATPase, thus transforming myosin-2 into a high-duty-ratio motor. This kinetic signature of the mutant allowed us to define the fractional occupancies of intermediate states during the ATPase cycle providing evidence that myosin populates a cleft-closure state of strong actin interaction during the weak-to-strong transition with bound hydrolysis products before accomplishing the power stroke.
Polyurethane (PU) coatings were successfully produced using unmodified kraft lignin (KL) as an environmentally benign component in contents of up to 80 wt%. Lignin samples were precipitated from industrial black liquor in aqueous solution working at room temperature and different pH levels (pH 2 to pH 5). Lignins were characterized by UV-Vis, FTIR, pyrolysis-GC/MS, SEC and 31P-NMR. Results show a correlation between pH level, OH number and molecular weight Mw of isolated lignins. Lignin-based polyurethane coatings were prepared in an efficient one step synthesis dissolving lignin in THF and PEG425 in an ultrasonic bath followed by addition of 4,4-diphenylmethanediisocyanate (MDI) and triethylamine (TEA). Crosslinking was achieved under very mild conditions (1 hour at room temperature followed by 3 hours at 35 °C). The resulting coatings were characterized regarding their physical properties including ATR-IR, TGA, optical contact angle, light microscopy, REM-EDX and AFM data. Transparent homogeneous films of high flexibility resulted from lignins isolated at pH 4, possessing a temperature resistance up to 160 °C. Swelling tests revealed a resistance against water. Swelling in DMSO depends on index, pH of precipitation and catalyst utilization for PU preparation. According to AFM studies, surface roughness is between 10 and 28 nm.
The development of metals tailored to the metallurgical conditions of laser-based additive manufacturing is crucial to advance the maturity of these materials for their use in structural applications. While efforts in this regard are being carried out around the globe, the use of high strength eutectic alloys have, so far, received minor attention, although previous works showed that rapid solidification techniques can result in ultrafine microstructures with excellent mechanical performance, albeit for small sample sizes. In the present work, a eutectic Ti-32.5Fe alloy has been produced by laser powder bed fusion aiming at exploiting rapid solidification and the capability to produce bulk ultrafine microstructures provided by this processing technique.
Process energy densities between 160 J/mm³ and 180 J/mm³ resulted in a dense and crack-free material with an oxygen content of ~ 0.45 wt.% in which a hierarchical microstructure is formed by µm-sized η-Ti4Fe2Ox dendrites embedded in an ultrafine eutectic β-Ti/TiFe matrix. The microstructure was studied three-dimensionally using near-field synchrotron ptychographic X-ray computed tomography with an actual spatial resolution down to 39 nm to analyse the morphology of the eutectic and dendritic structures as well as to quantify their mass density, size and distribution. Inter-lamellar spacings down to ~ 30–50 nm were achieved, revealing the potential of laser-based additive manufacturing to generate microstructures smaller than those obtained by classical rapid solidification techniques for bulk materials. The alloy was deformed at 600 °C under compressive loading up to a strain of ~ 30% without damage formation, resulting in a compressive yield stress of ~ 800 MPa.
This study provides a first demonstration of the feasibility to produce eutectic Ti-Fe alloys with ultrafine microstructures by laser powder bed fusion that are suitable for structural applications at elevated temperature.
Ultra-fast photopolymerization of experimental composites: DEA and FT-NIRS measurement comparison
(2015)
The epithelial sodium channel (ENaC) plays a key role in salt and water homeostasis in tetrapod vertebrates. There are four ENaC subunits (α, β, γ, δ), forming heterotrimeric αβγ- or δβγ-ENaCs. While the physiology of αβγ-ENaC is well understood, for decades the field has stalled with respect to δβγ-ENaC due to the lack of mammalian model organisms. The SCNN1D gene coding for δ-ENaC was previously believed to be absent in rodents, hindering studies using standard laboratory animals. We analysed all currently available rodent genomes and discovered that SCNN1D is present in rodents but was independently lost in five rodent lineages, including the Muridae (mice and rats). The independent loss of SCNN1D in rodent lineages may be constrained by phylogeny and taxon-specific adaptation to dry habitats, however habitat aridity does not provide a selection pressure for maintenance of SCNN1D across Rodentia. A fusion of two exons coding for a structurally flexible region in the extracellular domain of δ-ENaC appeared in the Hystricognathi (a group that includes guinea pigs). This conserved pattern evolved at least 41 Ma ago and represents a new autapomorphic feature for this clade. Exon fusion does not impair functionality of guinea pig (Cavia porcellus) δβγ-ENaC expressed in Xenopus oocytes. Electrophysiological characterisation at the whole-cell and single-channel level revealed conserved biophysical features and mechanisms controlling guinea pig αβγ- and δβγ-ENaC function as compared to human orthologues. Guinea pigs therefore represent commercially available mammalian model animals that will help shed light on the physiological function of δ-ENaC.
Development of colored surfaces by formation of nano-structured aggregates is a widely used strategy in nature to color lightweight structures (e.g. butterflies) without the use of dye pigments. The deposition of nanoscale particles mimics nature in it’s approach coloring surfaces. This work presents sol-gel modification of cellulose surfaces used to form a template for growth of Cu/Cu2O core-shell particles with defined size-distributions. Besides improving the adhesion of the deposited particulate material, the sol-gel matrix serves as a template for the control of particle sizes of the Cu/Cu2O structures, and as a consequence of particle size variation the surface color is tunable. As an example, red color was achieved with an average particle size of 35 nm, and shifts gradually to blue appearance when particles have grown to 80 nm on the sol-gel modified fabric. The copper concentration on representative fabrics is kept low to avoid modifying the textile characteristics and were all in the range of 150–170 mg per g of cellulose material. As a result of copper deposition on the surface of the material, the cellulose fabric also became electrically conductive. Remarkably, the electrical conductivity was found to be dependent on the average particle sizes of the deposits and thus related to the change in observed color. The generation of color by growth of nano-sized particles on sol-gel templates provides a highly promising approach to stain surfaces by physical effects without use of synthetic colorants, which opens a new strategy to improve environmental profile of coloration.
The non-filarial and non-communicable disease podoconiosis affects around 4 million people and is characterized by severe leg lymphedema accompanied with painful intermittent acute inflammatory episodes, called acute dermatolymphangioadenitis (ADLA) attacks. Risk factors have been associated with the disease but the mechanisms of pathophysiology remain uncertain. Lymphedema can lead to skin lesions, which can serve as entry points for bacteria that may cause ADLA attacks leading to progression of the lymphedema. However, the microbiome of the skin of affected legs from podoconiosis individuals remains unclear. Thus, we analysed the skin microbiome of podoconiosis legs using next generation sequencing. We revealed a positive correlation between increasing lymphedema severity and non-commensal anaerobic bacteria, especially Anaerococcus provencensis, as well as a negative correlation with the presence of Corynebacterium, a constituent of normal skin flora. Disease symptoms were generally linked to higher microbial diversity and richness, which deviated from the normal composition of the skin. These findings show an association of distinct bacterial taxa with lymphedema stages, highlighting the important role of bacteria for the pathogenesis of podoconiosis and might enable a selection of better treatment regimens to manage ADLA attacks and disease progression.
Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC50 of 50 μM. The binding motif can influence the activity of Hsp90 by hindering ATP accessibility or the release of ADP.
Bone regeneration and replacement is a major focus in regenerative medicine since degenerative diseases and tumor surgery as well as accidents or dangerous recreational behavior is leading to an increasing need for bone reconstruction strategies. Especially for critical size bone defects, tissue engineering with mesenchymal stem cells is extensively studied because these cells are functioning as precursors for osteoblast in vivo. Nevertheless to reproduce the complex interaction of various factors in vitro is not an easy approach and further investigations have to be done. The status quo is summarized. A variety of growth and transcription factors are known to be involved in osteogenesis with bone morphogenetic proteins (BMPs) and the transcription factor Runx2 being the most extensively studied ones. But also PPAR γ and Osterix are generally regarded as the master regulators of osteoblast differentiation. Recently the large family of purinergic receptors has proven to be essential molecules in osteogenesis as well. In addition, scaffolding is needed to create a three-dimensional tissue. Recent developments in scaffold design are summarized, including natural and synthetic materials with or without the use of bioactive molecules constructed to mimic the natural environment. The status quo of scaffold fabrication methods such as 3D nanoprinting and their influence on cell-scaffold interactions is discussed. In this review we summarize the most interesting results and our related work focusing on two joined approaches: 1) the complex interaction of the most promising factors improving or accelerating osteogenic differentiation and ii) the development of scaffold materials with osteoconductive and osteoinductive properties.
Transient up-regulation of P2 receptors influence differentiation of human mesenchymal stem cells
(2012)
Toshiyuki Fukao
(2020)
With increasing life expectancy, demands for dental tissue and whole-tooth regeneration are becoming more significant. Despite great progress in medicine, including regenerative therapies, the complex structure of dental tissues introduces several challenges to the field of regenerative dentistry. Interdisciplinary efforts from cellular biologists, material scientists, and clinical odontologists are being made to establish strategies and find the solutions for dental tissue regeneration and/or whole-tooth regeneration. In recent years, many significant discoveries were done regarding signaling pathways and factors shaping calcified tissue genesis, including those of tooth. Novel biocompatible scaffolds and polymer-based drug release systems are under development and may soon result in clinically applicable biomaterials with the potential to modulate signaling cascades involved in dental tissue genesis and regeneration. Approaches for whole-tooth regeneration utilizing adult stem cells, induced pluripotent stem cells, or tooth germ cells transplantation are emerging as promising alternatives to overcome existing in vitro tissue generation hurdles. In this interdisciplinary review, most recent advances in cellular signaling guiding dental tissue genesis, novel functionalized scaffolds and drug release material, various odontogenic cell sources, and methods for tooth regeneration are discussed thus providing a multi-faceted, up-to-date, and illustrative overview on the tooth regeneration matter, alongside hints for future directions in the challenging field of regenerative dentistry.
Thermo-chemical conversion of cucumber peel waste for biobased energy and chemical production
(2022)
There & Back again: Developing a tool for testing of antimicrobial surfaces for space habitat design
(2023)
Therapeutic Treatments for Osteoporosis-Which Combination of Pills Is the Best among the Bad?
(2022)
Osteoporosis is a chronical, systemic skeletal disorder characterized by an increase in bone resorption, which leads to reduced bone density. The reduction in bone mineral density and therefore low bone mass results in an increased risk of fractures. Osteoporosis is caused by an imbalance in the normally strictly regulated bone homeostasis. This imbalance is caused by overactive bone-resorbing osteoclasts, while bone-synthesizing osteoblasts do not compensate for this. In this review, the mechanism is presented, underlined by in vitro and animal models to investigate this imbalance as well as the current status of clinical trials. Furthermore, new therapeutic strategies for osteoporosis are presented, such as anabolic treatments and catabolic treatments and treatments using biomaterials and biomolecules. Another focus is on new combination therapies with multiple drugs which are currently considered more beneficial for the treatment of osteoporosis than monotherapies. Taken together, this review starts with an overview and ends with the newest approaches for osteoporosis therapies and a future perspective not presented so far.
Although p27 plays a central role in cell cycle regulation, its role in breast cancer prognosis is controversial. Furthermore, the p27 gene CDKN1B carries a polymorphism with unknown functional relevance. This study was designed to evaluate p27 expression and p27 genotyping with respect to early breast cancer prognosis. 279 patients with infiltrating metastasis-free breast cancer were included in this study. p27 expression was determined in tumor tissue specimens from 261 patients by immunohistochemistry. From 108 patients, the CDKN1B genotype was examined by PCR and subsequent direct sequencing. 55.2% of the tumors were considered p27 positive. p27 expression did not correlate with any of the established parameters except for nodal involvement but significantly correlated to prolonged disease-free survival. In 35% of the tumors analyzed, the CDKN1B gene showed a polymorphism at codon 109 (V109G). The V109G polymorphism correlated with greater nodal involvement. In the node-negative subgroup, V109G correlated significantly with a shortened disease-free survival. In conclusion, the determination of the CDKN1B genotype might be a powerful tool for the prognosis of patients with early breast cancer.
In 2018, in the US alone, it is estimated that 268,670 people will be diagnosed with breast cancer, and that 41,400 will die from it. Since breast cancers often become resistant to therapies, and certain breast cancers lack therapeutic targets, new approaches are urgently required. A cell-stress response pathway, the unfolded protein response (UPR), has emerged as a promising target for the development of novel breast cancer treatments. This pathway is activated in response to a disturbance in endoplasmic reticulum (ER) homeostasis but has diverse physiological and disease-specific functions. In breast cancer, UPR signalling promotes a malignant phenotype and can confer tumours with resistance to widely used therapies. Here, we review several roles for UPR signalling in breast cancer, highlighting UPR-mediated therapy resistance and the potential for targeting the UPR alone or in combination with existing therapies.
Autoantibodies in sera from patients with autoimmune diseases have long been known and have become diagnostic tools. Analysis of their functional role again became popular with the availability of mice mutant for several genes of the complement and Fcγ receptor (FcγR) systems. Evidence from different inflammatory models suggests that both systems are interconnected in a hierarchical way. The complement system mediators such as complement component 5a (C5a) might be crucial in the communication between the complement system and FcγR-expressing cells. The split complement protein C5a is known to inactivate cells by its G-protein-coupled receptor and to be involved in the transcriptional regulation of FcγRs, thereby contributing to the complex regulation of autoimmune disease.
A major challenge modern society has to face is the increasing need for tissue regeneration due to degenerative diseases or tumors, but also accidents or warlike conflicts. There is great hope that stem cell-based therapies might improve current treatments of cardiovascular diseases, osteochondral defects or nerve injury due to the unique properties of stem cells such as their self-renewal and differentiation potential. Since embryonic stem cells raise severe ethical concerns and are prone to teratoma formation, adult stem cells are still in the focus of research. Emphasis is placed on cellular signaling within these cells and in between them for a better understanding of the complex processes regulating stem cell fate. One of the oldest signaling systems is based on nucleotides as ligands for purinergic receptors playing an important role in a huge variety of cellular processes such as proliferation, migration and differentiation. Besides their natural ligands, several artificial agonists and antagonists have been identified for P1 and P2 receptors and are already used as drugs. This review outlines purinergic receptor expression and signaling in stem cells metabolism. We will briefly describe current findings in embryonic and induced pluripotent stem cells as well as in cancer-, hematopoietic-, and neural crest-derived stem cells. The major focus will be placed on recent findings of purinergic signaling in mesenchymal stem cells addressed in in vitro and in vivo studies, since stem cell fate might be manipulated by this system guiding differentiation towards the desired lineage in the future.
One of the primary current astrobiological goals is to understand the limits of microbial resistance to extraterrestrial conditions. Much attention is paid to ionizing radiation, since it can prevent the preservation and spread of life outside the Earth. The aim of this research was to study the impact of accelerated He ions (150 MeV/n, up to 1 kGy) as a component of the galactic cosmic rays on the black fungus C. antarcticus when mixed with Antarctic sandstones—the substratum of its natural habitat—and two Martian regolith simulants, which mimics two different evolutionary stages of Mars. The high dose of 1 kGy was used to assess the effect of dose accumulation in dormant cells within minerals, under long-term irradiation estimated on a geological time scale. The data obtained suggests that viable Earth-like microorganisms can be preserved in the dormant state in the near-surface scenario for approximately 322,000 and 110,000 Earth years within Martian regolith that mimic early and present Mars environmental conditions, respectively. In addition, the results of the study indicate the possibility of maintaining traces within regolith, as demonstrated by the identification of melanin pigments through UltraViolet-visible (UV-vis) spectrophotometric approach.
Background: Staurosporine-dependent single and collective cell migration patterns of breast carcinoma cells MDA-MB-231, MCF-7, and SK-BR-3 were analysed to characterise the presence of drug-dependent migration promoting and inhibiting yin-yang effects. Methods: Migration patterns of various breast cancer cells after staurosporine treatment were investigated using Western blot, cell toxicity assays, single and collective cell migration assays, and video time-lapse. Statistical analyses were performed with Kruskal–Wallis and Fligner–Killeen tests. Results: Application of staurosporine induced the migration of single MCF-7 cells but inhibited collective cell migration. With the exception of low-density SK-BR-3 cells, staurosporine induced the generation of immobile flattened giant cells. Video time-lapse analysis revealed that within the borderline of cell collectives, staurosporine reduced the velocity of individual MDA-MB-231 and SK-BR-3, but not of MCF-7 cells. In individual MCF-7 cells, mainly the directionality of migration became disturbed, which led to an increased migration rate parallel to the borderline, and hereby to an inhibition of the migration of the cell collective as a total. Moreover, the application of staurosporine led to a transient activation of ERK1/2 in all cell lines. Conclusion: Dependent on the context (single versus collective cells), a drug may induce opposite effects in the same cell line.
The Potential of Sustainable Antimicrobial Additives for Food Packaging from Native Plants in Benin
(2019)
Mesenchymal stem cells (MSCs) are an attractive cell source for Regenerative Dentistry in particular due to their ability to differentiate towards osteoblasts, among other lineages. Tooth and jaw bone loss are frequent sequelae of traumatic and pathological conditions in both the young and the elderly and must be met by appropriate prosthetic replacements. For successful osseointegration of the dental implant a sufficient bone level is necessary. Besides the utilization of bone autografts or synthetic biomaterials, medical research is more and more focused on the utilization of MSCs. Compared to cells obtained from liposuction material, ectomesenchymal stem cells derived from the head area e.g. out of dental follicles or particulate, non-vascularized bone chips show a higher differentiation potential towards osteoblasts.
The ability to discriminate between different ionic species, termed ion selectivity, is a key feature of ion channels and forms the basis for their physiological function. Members of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily of trimeric ion channels are typically sodium selective, but to a surprisingly variable degree. While acid-sensing ion channels (ASICs) are weakly sodium selective (sodium:potassium ratio ∼10:1), ENaCs show a remarkably high preference for sodium over potassium (>500:1). This discrepancy may be expected to originate from differences in the pore-lining second transmembrane segment (M2). However, these show a relatively high degree of sequence conservation between ASICs and ENaCs, and previous functional and structural studies could not unequivocally establish that differences in M2 alone can account for the disparate degrees of ion selectivity. By contrast, surprisingly little is known about the contributions of the first transmembrane segment (M1) and the preceding pre-M1 region. In this study, we used conventional and noncanonical amino acid-based mutagenesis in combination with a variety of electrophysiological approaches to show that the pre-M1 and M1 regions of mASIC1a channels are major determinants of ion selectivity. Mutational investigations of the corresponding regions in hENaC show that these regions contribute less to ion selectivity, despite affecting ion conductance. In conclusion, our work suggests that the remarkably different degrees of sodium selectivity in ASICs and ENaCs are achieved through different mechanisms. These results further highlight how M1 and pre-M1 are likely to differentially affect pore structure in these related channels.
The ability to discriminate between different ionic species, termed ion selectivity, is a key feature of ion channels and forms the basis for their physiological function. Members of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily of trimeric ion channels are typically sodium selective, but to a surprisingly variable degree. While acid-sensing ion channels (ASICs) are weakly sodium selective (sodium:potassium around 10:1), ENaCs show a remarkably high preference for sodium over potassium (>500:1). The most obvious explanation for this discrepancy may be expected to originate from differences in the pore-lining second transmembrane segment (M2). However, these show a relatively high degree of sequence conservation between ASICs and ENaCs and previous functional and structural studies could not unequivocally establish that differences in M2 alone can account for the disparate degrees of ion selectivity. By contrast, surprisingly little is known about the contributions of the first transmembrane segment (M1) and the preceding pre-M1 region. In this study, we use conventional and non-canonical amino acid-based mutagenesis in combination with a variety of electrophysiological approaches to show that the pre-M1 and M1 regions of mASIC1a channels are major determinants of ion selectivity. Mutational investigations of the corresponding regions in hENaC show that they contribute less to ion selectivity, despite affecting ion conductance. In conclusion, our work supports the notion that the remarkably different degrees of sodium selectivity in ASICs and ENaCs are achieved through different mechanisms. The results further highlight how M1 and pre-M1 are likely to differentially affect pore structure in these related channels.
Exposure to microgravity conditions causes cardiovascular deconditioning in astronauts during spaceflight. Until now, no specific drugs are available for countermeasure, since the underlying mechanism is largely unknown. Endothelial cells (ECs) and smooth muscle cells (SMCs) play key roles in various vascular functions, many of which are regulated by purinergic 2 (P2) receptors. However, their function in ECs and SMCs under microgravity conditions is still unclear. In this study, primary ECs and SMCs were isolated from bovine aorta and verified with specific markers. We show for the first time that the P2 receptor expression pattern is altered in ECs and SMCs after 24 h exposure to simulated microgravity using a clinostat. However, conditioned medium compensates this change in specific P2 receptors, for example, P2X7. Notably, P2 receptors such as P2X7 might be the important players during the paracrine interaction. Additionally, ECs and SMCs secreted different cytokines under simulated microgravity, leading into a pathogenic proliferation and migration. In conclusion, our data indicate P2 receptors might be important players responding to gravity changes in ECs and SMCs. Since some artificial P2 receptor ligands are applied as drugs, it is reasonable to assume that they might be promising candidates against cardiovascular deconditioning in the future.
Isovaleric acidemia (IVA), due to isovaleryl-CoA dehydrogenase (IVD) deficiency, results in the accumulation of isovaleryl-CoA, isovaleric acid and secondary metabolites. The increase in these metabolites decreases mitochondrial energy production and increases oxidative stress. This contributes to the neuropathological features of IVA. A general assumption in the literature exists that glycine N-acyltransferase (GLYAT) plays a role in alleviating the symptoms experienced by IVA patients through the formation of N-isovalerylglycine. GLYAT forms part of the phase II glycine conjugation pathway in the liver and detoxifies excess acyl-CoA’s namely benzoyl-CoA. However, very few studies support GLYAT as the enzyme that conjugates isovaleryl-CoA to glycine. Furthermore, GLYATL1, a paralogue of GLYAT, conjugates phenylacetyl-CoA to glutamine. Therefore, GLYATL1 might also be a candidate for the formation of N-isovalerylglycine. Based on the findings from the literature review, we proposed that GLYAT or GLYATL1 can form N-isovalerylglycine in IVA patients. To test this hypothesis, we performed an in-silico analysis to determine which enzyme is more likely to conjugate isovaleryl-CoA with glycine using AutoDock Vina. Thereafter, we performed in vitro validation using purified enzyme preparations. The in-silico and in vitro findings suggested that both enzymes could form N-isovaleryglycine albeit at lower affinities than their preferred substrates. Furthermore, an increase in glycine concentration does not result in an increase in N-isovalerylglycine formation. The results from the critical literature appraisal, in-silico, and in vitro validation, suggest the importance of further investigating the reaction kinetics and binding behaviors between these substrates and enzymes in understanding the pathophysiology of IVA.
This study investigates the effects of four multifunctional chain-extending cross-linkers (CECL) on the processability, mechanical performance, and structure of polybutylene adipate terephthalate (PBAT) and polylactic acid (PLA) blends produced using film blowing technology. The newly developed reference compound (M·VERA® B5029) and the CECL modified blends are characterized with respect to the initial properties and the corresponding properties after aging at 50 °C for 1 and 2 months. The tensile strength, seal strength, and melt volume rate (MVR) are markedly changed after thermal aging, whereas the storage modulus, elongation at the break, and tear resistance remain constant. The degradation of the polymer chains and crosslinking with increased and decreased MVR, respectively, is examined thoroughly with differential scanning calorimetry (DSC), with the results indicating that the CECL-modified blends do not generally endure thermo-oxidation over time. Further, DSC measurements of 25 µm and 100 µm films reveal that film blowing pronouncedly changes the structures of the compounds. These findings are also confirmed by dynamic mechanical analysis, with the conclusion that tris(2,4-di-tert-butylphenyl)phosphite barely affects the glass transition temperature, while with the other changes in CECL are seen. Cross-linking is found for aromatic polycarbodiimide and poly(4,4-dicyclohexylmethanecarbodiimide) CECL after melting of granules and films, although overall the most synergetic effect of the CECL is shown by 1,3-phenylenebisoxazoline.
The Chemotype of Chromanones as a Privileged Scaffold for Multineurotarget Anti-Alzheimer Agents
(2022)
Background: Bile acids, end products of the pathway for cholesterol elimination, are required for dietary lipid and fatsoluble vitamin absorption and maintain the balance between cholesterol synthesis in the liver and cholesterol excretion. They are composed of a steroid structure and are primarily made in the liver by the oxidation of cholesterol. Cholesterol is also highly abundant in the human ovarian follicle, where it is used in the formation of the sex steroids.
Methodology/Principal Findings: Here we describe for the first time evidence that all aspects of the bile acid synthesis pathway are present in the human ovarian follicle, including the enzymes in both the classical and alternative pathways, the nuclear receptors known to regulate the pathway, and the end product bile acids. Furthermore, we provide functional evidence that bile acids are produced by the human follicular granulosa cells in response to cholesterol presence in the culture media.
Conclusions/Significance: These findings establish a novel pathway present in the human ovarian follicle that has the capacity to compete directly with sex steroid synthesis.
Solid-Phase Microextraction (SPME) is a very simple and efficient, solventless sample preparation method, invented by Pawliszyn and coworkers at the University of Waterloo (Canada) in 1989. This method has been widely used in different fields of analytical chemistry since its first applications to environmental and food analysis. SPME integrates sampling, extraction, concentration and sample introduction into a single solvent-free step. The method saves preparation time, disposal costs and can improve detection limits. It has been routinely used in combination with gas chromatography (GC) and gas chromatography/mass spectrometry (GC/MS) and successfully applied to a wide variety of ompounds, especially for the extraction of volatile and semi-volatile organic compounds from environmental, biological and food samples.
Since the last twenty years, SPME in headspace (HS) mode is used as a valuable sample preparation technique for identifying degradation products in polymers and for determination of rest monomers and other light-boiling substances in polymeric materials. For more than ten years, our laboratory has been involved in projects focused on the application of HS-SPME-GC/MS for the characterization of polymeric materials from many branches of manufacturing and building industries. This book chapter describes the application examples of this technique for identifying volatile organic compounds (VOCs), additives and degradation products in industrial plastics, rubber, and packaging materials.
Traditional and newly developed testing methods were used for extensive application-related characterization of transdermal therapeutic systems (TTS) and pressure sensitive adhesives (PSA). Large amplitude oscillatory shear tests of PSAs were correlated to the material behavior during the patient’s motion and showed that all PSAs were located close to the gel point. Furthermore, an increasing strain amplitude results in stretching and yielding of the PSA´s microstructure causing a consolidation of the network and a release with increasing strain amplitude. RheoTack approach was developed to allow for an advanced tack characterization of TTS with visual inspection. The results showed a clear resin content and rod geometry dependent behavior, and displays the PSA´s viscoelasticity resulting in either high tack and long stretched fibrils or non-adhesion and brittle behavior. Moreover, diffusion of water / sweat during TTS´s application might influence its performance. Therefore, a dielectric analysis based evaluation method displayed occurring water diffusion into the PSA from which the diffusion coefficient can be determined, and showed clear material and resin content dependent behavior. All methods allow for an advanced product-oriented material testing that can be utilized within further TTS development.
Temperature Dependency of Morphological Structure of Thermoplastic Polyurethane using WAXS and SAXS
(2016)
Polyurethanes achieved an exceptional position among the most important organic polymers due to their highly specific technological application areas. Polyurethanes represent a polyaddition product of isocyanate and diols. In terms of their enormous industrial importance, the chemistry of isocyanates has been extensively studied.
Amaç: Keton cisim oluşumu (ketogenez) bozuklukları; mitokondriyel 3-hidroksi-3metil glutaril CoA sentaz (Mhs) ve 3-hidroksi-3-metil glutaril CoA liyaz (HL) enzim eksiklikleri sonucu oluşur. Keton cisim yıkımı (ketoliz) bozuklukları ise suksinil CoA: 3 oksoasit CoA transferaz (SCOT) ve asetoasetil CoA thiolaz-beta ketotiolaz (MAT) enzim eksiklikleri sonucu oluşmaktadır. Keton metabolizma bozukluğu tanısıyla izlenen hastaların klinik ve laboratuvar bulguları ile değerlendirilmesi amaçlandı.
Yöntem: Keton metabolizması bozukluğu tanısıyla izlenen hasta verileri retrospektif olarak incelendi.
Bulgular: Dört hastada HL eksikliği, 3 hastada MAT eksikliği ve 2 hastada SCOT eksikliği tanısı mevcuttu. Hastaların ortanca yaşı 5 yıl (6 ay-15,5 yıl), ilk metabolik dekompanzasyon atak yaşı ortalama 7,7 ay (22 gün-19 ay) idi. MAT eksikliği olan bir hasta, kardeş taraması ile asemptomatik dönemde tanı aldı. İki hastada spastik tetraparezi gibi ağır nörolojik defisit gelişti. Dekompanzasyon ataklarının beslenememe, kusma ve gastroenterit gibi infeksiyon sonrası geliştiği görüldü.
Sonuç: Açıklanamayan metabolik asidoz atakları durumunda keton metabolizma bozuklukları akılda tutulmalıdır. Akut dekompanzasyon değişik yaşlarda ortaya çıkabilir, klinik şiddeti değişken olabilir. Erken tanı ve uygun tedavi mortalite ve morbidite açısından çok önemlidir.
Dieses Buch ganz besonders dazu geeignet, Studierenden in den ersten Semestern den Zugang zur Technischen Mechanik zu öffnen und ihnen dabei zu helfen, diese gefürchtete Prüfung des Maschinenbaustudiums erfolgreich zu bestehen. Mit rund 120 Beispielen und Aufgaben mit detaillierten Lösungen sowie Fallstudien zu interessanten mechanischen Fragen.
Ob im Studium oder in der Praxis - bei der technischen Chemie kommt man schnell an seine Grenzen. Aber keine Sorge, "Technische Chemie für Dummies" hilft Ihnen, bei diesem komplexen Thema den Durchblick zu behalten. Nach einem allgemeinen Überblick über die Entwicklungen, Herausforderungen und Konzepte der technischen Chemie und einer verständlichen Übersicht über die nötige Mathematik lernen Sie, was man bei der praktischen und theoretischen Vorarbeit beachten muss, um die chemische Reaktion später in einem größeren Maßstab durchführen zu können. Anschließend erfahren Sie alles über Reaktionsmodellierung, Katalysatoren und chemische Reaktoren. Idealisierte Modelle helfen Ihnen dabei, aber auch die Umsetzung unter realen Bedingungen kommt nicht zu kurz. Der Verfahrenstechnik ist ein eigener Teil gewidmet, damit auch Trenntechnik, Strömungsmechanik, Fluidströmungen, Dimensionierung und Co. bald kein Problem mehr für Sie sind.
Background: the potency of drugs that interfere with glucose metabolism, i.e., glucose transporters (GLUT) and nicotinamide phosphoribosyltransferase (NAMPT) was analyzed in neuroendocrine tumor (NET, BON-1, and QPG-1 cells) and small cell lung cancer (SCLC, GLC-2, and GLC-36 cells) tumor cell lines. (2) Methods: the proliferation and survival rate of tumor cells was significantly affected by the GLUT-inhibitors fasentin and WZB1127, as well as by the NAMPT inhibitors GMX1778 and STF-31. (3) Results: none of the NET cell lines that were treated with NAMPT inhibitors could be rescued with nicotinic acid (usage of the Preiss–Handler salvage pathway), although NAPRT expression could be detected in two NET cell lines. We finally analyzed the specificity of GMX1778 and STF-31 in NET cells in glucose uptake experiments. As previously shown for STF-31 in a panel NET-excluding tumor cell lines, both drugs specifically inhibited glucose uptake at higher (50 μM), but not at lower (5 μM) concentrations. (4) Conclusions: our data suggest that GLUT and especially NAMPT inhibitors are potential candidates for the treatment of NET tumors.
Tamoxifen therapy of invasive breast cancer has been associated with increased levels of endothelin-1 (ET-1) so that an endothelin-1 receptor (ETR) blockade has been suggested as a new therapeutic approach. This study analyzed the relationship between Tamoxifen and ET-1 signalling in invasive breast cancer. Using paraffinized tissue from 50 randomly chosen cases of invasive and in-situ ductal carcinoma from our archive, the expression of ETRs was analyzed by immune histology. ETRs were regularly detectable in normal breast tissue, but rarely in adjacent tumor areas (3/50 cases). By immunoprecipitation, a complex was found consisting of ET-1, estrogen receptors and Tamoxifen. Consequently, transcription of several target genes of ET-1 and estrogen receptors was detectable (interleukin-6, wnt-11 and a vimentin spliceform). In particular, the combination of Tamoxifen, ET-1, and estrogen receptors induced further increasing levels of these target genes. Some of these genes have been found upregulated in metastatically spreading breast cancer cells. We conclude: i) ETRs do not play a role in invasive or in-situ ductal breast cancer; ii) estrogen receptors and Tamoxifen build a complex with ET-1; and iii) upregulated transcription of target genes by ET-1–estrogen receptor–Tamoxifen complex may negatively influence breast cancer prognosis. These results indicate a role for ET-1 in Tamoxifen treated breast cancer patients leading to a potentially worsening prognosis.
Synthesis of Substituted Hydroxyapatite for Application in Bone Tissue Engineering and Drug Delivery
(2019)
Introduction: After cellulose, lignin represents the most abundant biopolymer on earth that accounts for up to 18-35 % by weight of lignocellulose biomass. Today, it is a by-product of the paper and pulping industry. Although lignin is available in huge amounts, mainly in form of so called black liquor produced via Kraft-pulping, processes for the valorization of lignin are still limited [1]. Due to its hyperbranched polyphenol-like structure, lignin gained increasing interest as biobased building block for polymer synthesis [2]. The present work is focused on extraction and purification of lignin from industrial black liquor and synthesis of lignin-based polyurethanes.
Due to increased emissions of palladium nanoparticles in recent years, it is important to develop analytical techniques to characterize these particles. The synthesis of defined and stable particles plays a key role in this process, as there are not many materials commercially available yet which could act as reference materials. Polyvinylpyrrolidone- (PVP-) stabilized palladium nanoparticles were synthesized through the reduction of palladium chloride by tetraethylene glycol (TEG) in the presence of KOH. Four different methods were used for particle size analysis of the palladium nanoparticles. Palladium suspensions were analyzed by scanning electron microscopy (SEM), small angle X-ray scattering (SAXS), single-particle ICP-MS (SP-ICP-MS), and X-ray diffraction (XRD). Secondary particles between 30 nm and 130 nm were detected in great compliance with SAXS and SP-ICP-MS. SEM analysis showed that the small particulates tend to form agglomerates.