Refine
H-BRS Bibliography
- yes (1005) (remove)
Departments, institutes and facilities
- Präsidium (226)
- Fachbereich Angewandte Naturwissenschaften (186)
- Fachbereich Informatik (172)
- Fachbereich Wirtschaftswissenschaften (149)
- Institut für Technik, Ressourcenschonung und Energieeffizienz (TREE) (131)
- Fachbereich Ingenieurwissenschaften und Kommunikation (121)
- Internationales Zentrum für Nachhaltige Entwicklung (IZNE) (100)
- Institut für funktionale Gen-Analytik (IFGA) (72)
- Fachbereich Sozialpolitik und Soziale Sicherung (43)
- Institute of Visual Computing (IVC) (40)
Document Type
- Article (423)
- Part of Periodical (235)
- Conference Object (102)
- Part of a Book (68)
- Report (54)
- Working Paper (42)
- Preprint (19)
- Bachelor Thesis (17)
- Master's Thesis (13)
- Other (10)
Year of publication
Has Fulltext
- yes (1005) (remove)
Keywords
- Hochschule Bonn-Rhein-Sieg (7)
- Machine Learning (7)
- Robotik (7)
- cytokine-induced killer cells (7)
- lignin (7)
- Digitalisierung (6)
- Lignin (6)
- Sustainability (6)
- immunotherapy (6)
- GC/MS (5)
Nur maximal ein Fünftel aller Menschen in Deutschland, die Maschinen entwickeln, technische Innovationen vorantreiben, optimieren oder reparieren, sind weiblich. Der Anteil von Frauen in technischen Berufen liegt derzeit bei etwa 20 Prozent (1). Vergleichbar niedrig ist auch die Zahl der Journalistinnen, die sich technischen Themen verschrieben haben. Technik und auch der Technikjournalismus sind hierzulande immer noch Männerdomänen.
Ohne Zweifel kein Wissen und keine Innovation, dies gilt für die Forschung im Allgemeinen und natürlich auch an unserer Hochschule. Gerade in der Wissenschaft ist der methodische Zweifel oft der Ausgangspunkt einer spezifischen Untersuchung. Er soll dabei behilflich sein, Klarheit zu erlangen. Frei nach dem Philosophen Rene Descartes: Was kann ich eigentlich mit Sicherheit wissen? Nur wer ab und an zweifelt, der schaut um die Ecke, stellt sich, andere und seine Umwelt in Frage, sucht nach neuen Wegen, Antworten und strebt nach Veränderung. Und auch dort, wo Wissenschaft vermittelt wird, also im Seminar, in einer Übung oder Vorlesung, muss Platz sein für eine selbstreflexive Grundhaltung. An der H-BRS ist Zweifeln also nicht nur erlaubt, sondern erwünscht.
Studienverläufe von Studenten weichen nicht selten vom offiziell geplanten Curriculum ab. Für eine den Studienerfolg verbessernde Planung und Weiterentwicklung von Studiengängen und Curricula fehlen den Verantwortlichen häufig Erkenntnisse über tatsächliche sowie typischerweise erfolgreiche und weniger erfolgreiche Studienverlaufsmuster. Process-Mining-Techniken können helfen, mehr Transparenz bei der Auswertung von Studienverläufen zu schaffen und so die Erkennung typischer Studienverlaufsmuster, die Überprüfung der Übereinstimmung der konkreten Studienverläufe mit dem vorgegebenen Curriculum sowie eine zielgerechte Verbesserung des Curriculums zu unterstützen.
Nachhaltige und zukunftsfähige Mobilität in Städten kann langfristig nur durch die aktive Partizipation ihrer Bürger und Institutionen erreicht werden. Betriebliches Mobilitätsmanagement (BMM) kann dabei einen positiven Beitrag im Hinblick auf Umwelt, Gesundheit und Kosten leisten. Die vorliegende Arbeit beschäftigt sich mit der Wahrnehmung gesundheitlicher und finanzieller Wertschöpfungsaspekte des BMM. Im Rahmen des Forschungsprojekts Betriebe lösen Verkehrsprobleme werden Mobilitätsverhalten und Maßnahmen der Betrieblichen Gesundheitsförderung (BFG) in Bonner Betrieben untersucht. Folgenden Aspekten wird besondere Beachtung geschenkt: Bedeutung Betrieblicher Gesundheitsförderung in Bonner Betrieben, Mobilitätsverhalten von Arbeitnehmern auf dem Weg zur Dienststelle, Wahrnehmung eines unmittelbaren Zusammenhangs zwischen körperlicher Aktivität und Gesundheit bzw. krankheitsbedingter Kosten und Umsatzeinbußen durch Bewegungsmangel. Die Analyse resultiert auf der Basis einer schriftlichen Befragung von 178 Unternehmen, einer Online-Umfrage von 1.341 Mitarbeitern aus 14 Unternehmen sowie auf persönlichen Interviews mit 22 Betriebsleitern bzw. Mobilitäts- und Gesundheitsbeauftragten. Die Ergebnisse der Studie machen sowohl Handlungsbedarf als auch Optimierungspotentiale im Bereich BMM auf Betriebsseite deutlich. Kostensimulationen zeigen darüber hinaus auf, dass durch die Implementierung von BGF-Maßnahmen, explizit der Förderung von Bewegung, auf betriebs- und volkswirtschaftlicher Seite beachtliche Kosten im Gesundheitsbereich eingespart sowie höhere Gewinne im Unternehmen erzielt werden können.
Zukunft nachhaltig gestalten
(2010)
Our study shows ZP2 to be a new biomarker for diagnosis, best used in combination with other low abundant genes in colon cancer. Furthermore, ZP2 promotes cell proliferation via the ERK1/2-cyclinD1-signaling pathway. We demonstrate that ZP2 mRNA is expressed in a low-abundant manner with high specificity in subsets of cancer cell lines representing different cancer subtypes and also in a significant proportion of primary colon cancers. The potential benefit of ZP2 as a biomarker is discussed. In the second part of our study, the function of ZP2 in cancerogenesis has been analyzed. Since ZP2 shows an enhanced transcript level in colon cancer cells, siRNA experiments have been performed to verify the potential role of ZP2 in cell proliferation. Based on these data, ZP2 might serve as a new target molecule for cancer diagnosis and treatment in respective cancer types such as colon cancer.
YAWL (Yet Another Workflow Language) is an open source Business Process Management System, first released in 2003. YAWL grew out of a university research environment to become a unique system that has been deployed worldwide as a laboratory environment for research in Business Process Management and as a productive system in other scientific domains.
XPERSIF: a software integration framework & architecture for robotic learning by experimentation
(2008)
The integration of independently-developed applications into an efficient system, particularly in a distributed setting, is the core issue addressed in this work. Cooperation between researchers across various field boundaries in order to solve complex problems has become commonplace. Due to the multidisciplinary nature of such efforts, individual applications are developed independent of the integration process. The integration of individual applications into a fully-functioning architecture is a complex and multifaceted task. This thesis extends a component-based architecture, previously developed by the authors, to allow the integration of various software applications which are deployed in a distributed setting. The test bed for the framework is the EU project XPERO, the goal of which is robot learning by experimentation. The task at hand is the integration of the required applications, such as planning of experiments, perception of parametrized features, robot motion control and knowledge-based learning, into a coherent cognitive architecture. This allows a mobile robot to use the methods involved in experimentation in order to learn about its environment. To meet the challenge of developing this architecture within a distributed, heterogeneous environment, the authors specified, defined, developed, implemented and tested a component-based architecture called XPERSIF. The architecture comprises loosely-coupled, autonomous components that offer services through their well-defined interfaces and form a service-oriented architecture. The Ice middleware is used in the communication layer. Its deployment facilitates the necessary refactoring of concepts. One fully specified and detailed use case is the successful integration of the XPERSim simulator which constitutes one of the kernel components of XPERO.The results of this work demonstrate that the proposed architecture is robust and flexible, and can be successfully scaled to allow the complete integration of the necessary applications, thus enabling robot learning by experimentation. The design supports composability, thus allowing components to be grouped together in order to provide an aggregate service. Distributed simulation enabled real time tele-observation of the simulated experiment. Results show that incorporating the XPERSim simulator has substantially enhanced the speed of research and the information flow within the cognitive learning loop.
XML Signature Wrapping (XSW) has been a relevant threat to web services for 15 years until today. Using the Personal Health Record (PHR), which is currently under development in Germany, we investigate a current SOAP-based web services system as a case study. In doing so, we highlight several deficiencies in defending against XSW. Using this real-world contemporary example as motivation, we introduce a guideline for more secure XML signature processing that provides practitioners with easier access to the effective countermeasures identified in the current state of research.
Wissen für die Wirtschaft
(2017)
Es gehörte zum Gründungsauftrag der Hochschule Bonn-Rhein-Sieg, Wissenschaft und Wirtschaft zusammenzubringen und gemeinsam Neues zu entwickeln. Die hier vorgestellte Broschüre ist vor allem als Anregung gedacht: Sie zeigt, welche Erfolge aus einer Zusammenarbeit erwachsen und erleichtert es Unternehmen, den ersten Schritt hin zu einer Kooperation mit der H-BRS zu gehen.
Evaluation is of crucial importance and should meet professional standards in its design. In practice, organizational peculiarities and available resources characterize the search for the "right" approach. When used as a quality development tool, internal or self-evaluation should primarily be useful. It should generate information to answer organizational questions and provide results as a basis for discussion in decision-making processes.
This study contributes to the growing body of research concerning management consultancies by linking two previously disparate fields of study: (1) the examination of the effectiveness of consulting interventions and (2) the examination of the social processes that aim to create and legitimize the insights, knowledge and capabilities of management consultancies. We propose that consulting firms accumulate social authority in the course of pre-intervention discourse processes that is reflected in their reputation and celebrity. With respect to intervention, this social authority affects change recipients’ commitment to and compliance with the requirements of change implementation. We test the proposed relationships by conducting a measured variable path analysis of 117 change initiatives in German companies that were set up and implemented with the assistance of external consultancies. Our findings indicate that a consulting firm’s levels of both celebrity and reputation affect the change recipients’ commitment to proposed change strategies and thus, indirectly affect their behavioral compliance with the explicit requirements of change implementation.
Risk-based authentication (RBA) aims to strengthen password-based authentication rather than replacing it. RBA does this by monitoring and recording additional features during the login process. If feature values at login time differ significantly from those observed before, RBA requests an additional proof of identification. Although RBA is recommended in the NIST digital identity guidelines, it has so far been used almost exclusively by major online services. This is partly due to a lack of open knowledge and implementations that would allow any service provider to roll out RBA protection to its users.
To close this gap, we provide a first in-depth analysis of RBA characteristics in a practical deployment. We observed N=780 users with 247 unique features on a real-world online service for over 1.8 years. Based on our collected data set, we provide (i) a behavior analysis of two RBA implementations that were apparently used by major online services in the wild, (ii) a benchmark of the features to extract a subset that is most suitable for RBA use, (iii) a new feature that has not been used in RBA before, and (iv) factors which have a significant effect on RBA performance. Our results show that RBA needs to be carefully tailored to each online service, as even small configuration adjustments can greatly impact RBA's security and usability properties. We provide insights on the selection of features, their weightings, and the risk classification in order to benefit from RBA after a minimum number of login attempts.
Risk-based authentication (RBA) aims to strengthen password-based authentication rather than replacing it. RBA does this by monitoring and recording additional features during the login process. If feature values at login time differ significantly from those observed before, RBA requests an additional proof of identification. Although RBA is recommended in the NIST digital identity guidelines, it has so far been used almost exclusively by major online services. This is partly due to a lack of open knowledge and implementations that would allow any service provider to roll out RBA protection to its users. To close this gap, we provide a first in-depth analysis of RBA characteristics in a practical deployment. We observed N=780 users with 247 unique features on a real-world online service for over 1.8 years. Based on our collected data set, we provide (i) a behavior analysis of two RBA implementations that were apparently used by major online services in the wild, (ii) a benchmark of the features to extract a subset that is most suitable for RBA use, (iii) a new feature that has not been used in RBA before, and (iv) factors which have a significant effect on RBA performance. Our results show that RBA needs to be carefully tailored to each online service, as even small configuration adjustments can greatly impact RBA's security and usability properties. We provide insights on the selection of features, their weightings, and the risk classification in order to benefit from RBA after a minimum number of login attempts.
Several species of (poly)saccharides and organic acids can be found often simultaneously in various biological matrices, e.g., fruits, plant materials, and biological fluids. The analysis of such matrices sometimes represents a challenging task. Using Aloe vera (A. vera) plant materials as an example, the performance of several spectroscopic methods (80 MHz benchtop NMR, NIR, ATR-FTIR and UV-Vis) for the simultaneous analysis of quality parameters of this plant material was compared. The determined parameters include (poly)saccharides such as aloverose, fructose and glucose as well as organic acids (malic, lactic, citric, isocitric, acetic, fumaric, benzoic and sorbic acids). 500 MHz NMR and high-performance liquid chromatography (HPLC) were used as the reference methods.
UV-VIS data can be used only for identification of added preservatives (benzoic and sorbic acids) and drying agent (maltodextrin) and semiquantitative analysis of malic acid. NIR and MIR spectroscopies combined with multivariate regression can deliver more informative overview of A. vera extracts being able to additionally quantify glucose, aloverose, citric, isocitric, malic, lactic acids and fructose. Low-field NMR measurements can be used for the quantification of aloverose, glucose, malic, lactic, acetic, and benzoic acids. The benchtop NMR method was successfully validated in terms of robustness, stability, precision, reproducibility and limit of detection (LOD) and quantification (LOQ), respectively.
All spectroscopic techniques are useful for the screening of (poly)saccharides and organic acids in plant extracts and should be applied according to its availability as well as information and confidence required for the specific analytical goal. Benchtop NMR spectroscopy seems to be the most feasible solution for quality control of A. vera products.
In January 2015, German trade and industry announced to support the national animal welfare initiative "Initiative Tierwohl" (ITW) which stands for a more sustainable and animal-friendly meat production. A web content analysis shows that the ITW initiative has been widely picked up and discussed by online media and that user comments are quite heterogeneous. The current study identifies different types of consumers through factor and cluster analysis and is based on an online survey as well as face-to-face interviews. According to our results, the identified consumer groups demonstrate a rather passive comment behaviour on the internet. In fact, the internet was hardly mentioned as an information source for meat production; consumers more frequently referred to brochures, leaflets and personal contacts with sales personnel.
The aim of this study was to investigate employees’ self-reported creativity before and after vacation and to examine the impact of recovery experiences (detachment, relaxation, mastery, meaning, autonomy, affiliation) on changes in creativity. The DRAMMA model of Newman et al. provides the theoretical background of our approach. Longitudinal data was assessed with four repeated measurements. The study encompassed data from 274 white-collar workers. Analyses showed that employees subjectively perceive their creativity to benefit not immediately after their vacation but 2 weeks later. Detachment was significantly related to lower creativity within persons, while mastery experiences explained differences in creativity between persons. This study provides a detailed picture of changes in creativity around vacations.
Die vorliegende Bachelorthesis setzt sich mit der Problematik auseinander, ob Produktbewertungen auf Youtube nutzwertjournalistisch sein können, wozu zunächst ein Kategoriensystem zur Identifikation von Nutzwertjournalismus entwickelt wird. Mithilfe der Methode der qualitativen Inhaltsanalyse und dem Kategoriensystem, werden vier Produkttests des Fotografie-Kanals Value-TechTV untersucht. Die Forschungsfrage lautet daher: Zählen die Produkttests des Kanals ValueTechTV zum Nutzwertjournalismus?
Although much effort is made to prevent risks arising from food, food-borne diseases are an ever present-threat to the consumers’ health. The consumption of fresh food that is contaminated with pathogens like fungi, viruses or bacteria can cause food poisoning that leads to severe health damages or even death. The outbreak of Shiga Toxin-producing enterohemorrhagic E. coli (EHEC) in Germany and neighbouring countries in 2011 has shown this dramatically. Nearly 4.000 people were reported of being affected and more than 50 people died during the so called EHEC-crisis. As a result the consumers’ trust in the safety of fruits and vegetables decreased sharply.
Although much effort is made to prevent risks arising from food, food-borne diseases are an ever-present threat to the consumers’ health. The consumption of fresh food that is contaminated with pathogens like fungi, viruses or bacteria can cause food poisoning that leads to severe health damages or even death. The outbreak of Shiga Toxin-producing enterohemorrhagic E. coli (EHEC) in Germany and neighbouring countries in 2011 has shown this dramatically. Nearly 4.000 people were reported of being affected and more than 50 people died during the so called EHEC-crisis. As a result the consumers’ trust in the safety of fruits and vegetables decreased sharply.
The transport sector is a major source of air pollution and thus a major contributor to the changing climate. As a result, in the recent past, driving bans have been imposed on cars with critical pollutant groups. As an international UN campus and self-proclaimed climate capital, the Federal City of Bonn declared a climate emergency in 2019 and participated in a federally funded “Lead City” project to optimise air quality. A key goal of the project is to reduce private motorised transport and strengthen public transport. Among the implemented measures, a “climate ticket” was introduced in 2019 whereby consumers could purchase an annual 365 € ticket for all local public transport. This paper reports on an analysis of that ticket’s changes in travel behavior.
A quantitative survey (n = 1,315) of the climate ticket users as well as the multiple regressions confirm that the climate ticket attracted more customers to the buses and trams and that a modal shift for the period of the measure was recognisable. The multiple regressions showed that the ticket was perceived significantly more positively by full-time employed users than by unemployed people. The results also show that, in addition to the price, it is essential that travel time and reliability are ensured. Furthermore, the eligible groups of people, the area of coverage, and good connecting services should be extended. To sustainably improve air quality, this type of mobility service must be optimised and introduced on a permanent basis.
Seit Sokrates bildet die Frage „Was macht ein glückliches Leben aus?“ den Ausgangspunkt der Entwicklung einer Vielfalt von Wohlbefindenstheorien. Den Kern dieses Aufsatzes bildet die Erörterung der Fragen, inwieweit das Konzept der empirischen Lebenszufriedenheit und die dadurch gewonnenen Korrelate einen Beitrag zur Beantwortung dieser Frage leisten und ob diese Antworten eine Wohlbefindenstheorie begründen können, welche die philosophische Theorie mit empirischen Ergebnissen verknüpft.
Im Zentrum dieses Aufsatzes steht eine Diskussion der wichtigsten Wohlbefindenstheorien, ihrer Qualitäten, Gemeinsamkeiten und Unterschiede. Einen Schwerpunkt bildet die Theorie der subjektiven Lebenszufriedenheit. Ich diskutiere Stärken und Schwächen des Konzeptes und stelle die wichtigsten Ergebnisse der empirischen Lebenszufriedenheitsforschung in einem Überblick dar.
Im Ergebnis argumentiere ich, dass die Resultate der empirischen Forschung als Grundlage einer subjektiv-objektiven Wohlbefindenstheorie dienen können. Qualitativ hochwertige zwischenmenschliche Beziehungen, ein gesunder Lebensstil, eine ausgewogene Work-Life-Balance, der Einsatz für Andere, das Verfolgen von Lebenszielen und persönlichen Interessen bilden die Grundlage einer Wohlbefindenstheorie, die sich auf empirische Lebenszufriedenheitsforschung stützt.
Was ist ein Labor?
(2022)
Der technische Fortschritt im Bereich der Erhebung, Speicherung und Verarbeitung von Daten macht es erforderlich, neue Fragen zu sozialverträglichen Datenmärkten aufzuwerfen. So gibt es sowohl eine Tendenz zur vereinfachten Datenteilung als auch die Forderung, die informationelle Selbstbestimmung besser zu schützen. Innerhalb dieses Spannungsfeldes bewegt sich die Idee von Datentreuhändern. Ziel des Beitrags ist darzulegen, dass zwischen verschiedenen Formen der Datentreuhänderschaft unterschieden werden sollte, um der Komplexität des Themas gerecht zu werden. Insbesondere bedarf es neben der mehrseitigen Treuhänderschaft, mit dem Treuhänder als neutraler Instanz, auch der einseitigen Treuhänderschaft, bei dem der Treuhänder als Anwalt der Verbraucherinteressen fungiert. Aus dieser Perspektive wird das Modell der Datentreuhänderschaft als stellvertretende Deutung der Interessen individueller und kollektiver Identitäten systematisch entwickelt.
Vorwort
(2022)
Vorwort
(2022)
Personal-Information-Management-Systeme (PIMS) gelten als Chance, um die Datensouveränität der Verbraucher zu stärken. Datenschutzbezogene Fragen sind für Verbraucher immer dort relevant, wo sie Verträge und Nutzungsbedingungen mit Diensteanbietern eingehen. Vor diesem Hintergrund diskutiert dieser Beitrag die Potenziale von VRM-Systemen, die nicht nur das Datenmanagement, sondern das gesamte Vertragsmanagement von Verbrauchern unterstützen. Dabei gehen wir der Frage nach, ob diese besser geeignet sind, um Verbraucher zu souveränem Handeln zu befähigen.
Quereinsteiger und Neulinge der Vermittlung von Informationskompetenz werden grundlegend auf der Basis der vielfältigen praktischen Erfahrungen des Multiplikatorennetzwerks der AG Informationskompetenz NRW über strategische Konzepte, unterschiedliche Schulungsangebote für verschiedene Zielgruppen, Methodik und Didaktik von Schulungsveranstaltungen, Organisation und Infrastruktur sowie Evaluation und Qualitätsmanagement informiert.
The development of mobile robotic systems is a demanding task regarding its complexity, required resources and skills in multiple fields such as software development, artificial intelligence, mechanical design, electrical engineering, signal processing, sensor technology or control theory. This holds true particularly for soccer playing robots, where additional aspects like high dynamics, cooperation and high physical stress have to be dealt with. In robot competitions such as RoboCup, additional skills in the domains of team, project and knowledge management are of importance.
Konsument:innen scheint die Lust vergangen zu sein, individuellen Kleidungsstil auszudrücken, da der Onlinehandel zur Steigerung von Auswahlmöglichkeiten geführt hat. Dies mündet unter anderem in der Nutzung virtueller Stilberatungen. Diese Dienste dienen dazu, Kund:innen möglichst effizient, individuell und authentisch „zu machen“, und sind somit als paradoxaler Demokratisierungsprozess zu verstehen. Eine Erklärung für den Erfolg dieser Dienstleistungen soll mit Reckwitz’ Singularisierungsthese gestützt werden.
Background: Virtual reality combined with spherical treadmills is used across species for studying neural circuits underlying navigation.
New Method: We developed an optical flow-based method for tracking treadmil ball motion in real-time using a single high-resolution camera.
Results: Tracking accuracy and timing were determined using calibration data. Ball tracking was performed at 500 Hz and integrated with an open source game engine for virtual reality projection. The projection was updated at 120 Hz with a latency with respect to ball motion of 30 ± 8 ms.
Comparison: with Existing Method(s) Optical flow based tracking of treadmill motion is typically achieved using optical mice. The camera-based optical flow tracking system developed here is based on off-the-shelf components and offers control over the image acquisition and processing parameters. This results in flexibility with respect to tracking conditions – such as ball surface texture, lighting conditions, or ball size – as well as camera alignment and calibration.
Conclusions: A fast system for rotational ball motion tracking suitable for virtual reality animal behavior across different scales was developed and characterized.
While humans can effortlessly pick a view from multiple streams, automatically choosing the best view is a challenge. Choosing the best view from multi-camera streams poses a problem regarding which objective metrics should be considered. Existing works on view selection lack consensus about which metrics should be considered to select the best view. The literature on view selection describes diverse possible metrics. And strategies such as information-theoretic, instructional design, or aesthetics-motivated fail to incorporate all approaches. In this work, we postulate a strategy incorporating information-theoretic and instructional design-based objective metrics to select the best view from a set of views. Traditionally, information-theoretic measures have been used to find the goodness of a view, such as in 3D rendering. We adapted a similar measure known as the viewpoint entropy for real-world 2D images. Additionally, we incorporated similarity penalization to get a more accurate measure of the entropy of a view, which is one of the metrics for the best view selection. Since the choice of the best view is domain-dependent, we chose demonstration-based training scenarios as our use case. The limitation of our chosen scenarios is that they do not include collaborative training and solely feature a single trainer. To incorporate instructional design considerations, we included the trainer’s body pose, face, face when instructing, and hands visibility as metrics. To incorporate domain knowledge we included predetermined regions’ visibility as another metric. All of those metrics are taken into account to produce a parameterized view recommendation approach for demonstration-based training. An online study using recorded multi-camera video streams from a simulation environment was used to validate those metrics. Furthermore, the responses from the online study were used to optimize the view recommendation performance with a normalized discounted cumulative gain (NDCG) value of 0.912, which shows good performance with respect to matching user choices.
Vielfalt ist unser Angebot
(2014)
Der Fachbereich Sozialversicherung der Hochschule Bonn-Rhein-Sieg blickt auf zehn erfolgreiche Jahre zurück. Seit Gründung des Fachbereichs im Jahr 2003 arbeiten Wissenschaftlerinnen und Wissenschaftler verschiedener Disziplinen auf dem Campus Hennef eng vernetzt im Untersuchungsfeld der Sozialversicherung.
Verwaltungs- und Benutzungsordnung der Hochschul- und Kreisbibliothek Bonn-Rhein-Sieg vom 18.07.2005
(2005)
Risk-based authentication (RBA) is an adaptive security measure to strengthen password-based authentication against account takeover attacks. Our study on 65 participants shows that users find RBA more usable than two-factor authentication equivalents and more secure than password-only authentication. We identify pitfalls and provide guidelines for putting RBA into practice.
Projekte des maschinellen Lernens (ML), insbesondere im Bereich der Zeitreihenanalyse, gewinnen heute zunehmend an Bedeutung. Die Bereitstellung solcher Projekte in einer Produktionsumgebung mit dem gleichen Automatisierungsgrad wie bei klassischen Softwareprojekten ist ein komplexes Unterfangen. Die Umsetzung in Produktionsumgebungen erfordert neben klassischen DevOps auch Machine Learning Operation (MLOps) Technologien und Werkzeuge. Ziel dieser Studie ist es, einen umfassenden Überblick über verfügbare MLOps Tools zu bieten und einen spezifischen Techstack für Zeitreihen ML Projekte zu entwickeln. Es werden aktuelle Trends und Werkzeuge im Bereich MLOps durch eine multivokale Literaturrecherche (MLR) untersucht und analysiert. Die Studie identifiziert passende MLOps Werkzeuge und Methoden für die Zeitreihenanalyse und präsentiert eine spezifische Implementierung einer MLOps Pipeline für die Aktienkursprognose des S&P 500. MLOps und DevOps Tools nehmen eine essenzielle Rolle bei der effektiven Konstruktion und Verwaltung von ML Pipelines ein. Bei der Auswahl geeigneter Werkzeuge ist stets eine spezifische Anpassung an die jeweiligen Projektanforderungen erforderlich. Die Bereitstellung einer detaillierten Darstellung der aktuellen MLOps Tool Landschaft erweist sich hierbei als wertvolle Ressource, die es Entwicklern ermöglicht, die Effizienz und Effektivität ihrer ML Projekte zu optimieren.
An der Hochschule Bonn-Rhein-Sieg fand am Donnerstag, den 23.9.21 das erste Verbraucherforum für Verbraucherinformatik statt. Im Rahmen der Online-Tagesveranstaltung diskutierten mehr als 30 Teilnehmer:innen über Themen und Ideen rund um den Bereich Verbraucherdatenschutz. Dabei kamen sowohl Beiträge aus der Informatik, den Verbraucher- und Sozialwissenschaften sowie auch der regulatorischen Perspektive zur Sprache. Der folgende Beitrag stellt den Hintergrund der Veranstaltung dar und berichtet über Inhalte der Vorträge sowie Anknüpfungspunkte für die weitere Konstituierung der Verbraucherinformatik. Veranstalter waren das Institut für Verbraucherinformatik an der H-BRS in Zusammenarbeit mit dem Lehrstuhl IT-Sicherheit der Universität Siegen sowie dem Kompetenzzentrum Verbraucherforschung NRW der Verbraucherzentrale NRW e. V. mit Förderung des Bundesministeriums der Justiz und für Verbraucherschutz.
An der Hochschule Bonn-Rhein-Sieg fand am Donnerstag, den 23.9.21 das erste Verbraucherforum für Verbraucherinformatik statt. Im Rahmen der Online-Tagesveranstaltung diskutierten mehr als 30 Teilnehmer:innen über Themen und Ideen rund um den Bereich Verbraucherdatenschutz. Dabei kamen sowohl Beiträge aus der Informatik, den Verbraucher- und Sozialwissenschaften sowie auch der regulatorischen Perspektive zur Sprache. Der folgende Beitrag stellt den Hintergrund der Veranstaltung dar und berichtet über Inhalte der Vorträge sowie Anknüpfungspunkte für die weitere Konstituierung der Verbraucherinformatik. Veranstalter waren das Institut für Verbraucherinformatik an der H-BRS in Zusammenarbeit mit dem Lehrstuhl IT-Sicherheit der Universität Siegen sowie dem Kompetenzzentrum Verbraucherforschung NRW der Verbraucherzentrale NRW e. V. mit Förderung des Bundesministeriums der Justiz und für Verbraucherschutz.
Das Forschungsprojekt beruht auf zwei Elementen: Die erste Untersuchung, ein Verhaltensexperiment mit 35 Studierenden der Hochschule Bonn-Rhein-Sieg, erforschte den Einfluss von Gruppengröße (Zuschauereffekt) und dargebotenen Informationen zu Verantwortungsdiffusion (Priming) auf nachhaltiges Verhalten. Mithilfe eines zweiten Online-Experiments folgte eine Erhebung zum Einfluss von wahrgenommener persönlicher Bedrohung auf die Bereitschaft zu nachhaltigem Verhalten (N = 72). Die Ergebnisse des ersten Experimentes zeigen einen schwachen, statistisch nicht signifikanten Einfluss der Gruppengröße sowie einen, z.T. statistisch signifikanten, Einfluss der dargebotenen Informationen zu Verantwortungsdiffusion auf das gemessene nachhaltige Verhalten. Bequemlichkeit sowie monetärer Aufwand stellen mit Abstand die größten Hindernisse für nachhaltiges Verhalten dar, während die Beeinflussung durch andere und das Ziel des Umweltschutzes als positive Argumente für nachhaltiges Verhalten genannt wurden. In der Folgestudie konnte ein statistisch signifikanter kausaler Zusammenhang zwischen der wahrgenommenen persönlichen Bedrohung durch die aktuelle Umwelt- und Klimasituation und der Bereitschaft zu nachhaltigem Verhalten nachgewiesen werden. Alle Resultate zu Verhaltensintentionen zeigten insgesamt eine hohe Bereitschaft der Probanden zu nachhaltigem Verhalten.
Die Jahresberichte der Hochschule Bonn-Rhein-Sieg haben jedes Mal ein anderes Schwerpunktthema. Für den Jahresbericht 2012 lautet das Thema "Verantwortlich handeln und Vorbild sein: Die Hochschule in der Gesellschaft".
Den Anfang bildet ein Gespräch zwischen dem Intendanten der Deutschen Welle, Erik Bettermann, und Hochschulpräsident Hartmut Ihne über Verantwortung in der Ausbildung und das Engagement in der Entwicklungszusammenarbeit. In den Kapiteln Studium & Lehre, Forschung, Campus, Region und Internationales findet sich ein vielfältiges Themenspektrum, wobei die Übergänge fließend sind, denn viele Themen ließen sich auch durchaus anderen Kapiteln zuordnen.
Sonderseiten sind in der neuen Ausgabe der "Pause" gewidmet: Forschungssemestern und Sabbatjahr, die Pause im wissenschaftlichen Fokus oder die ganz normale Kaffeepause. Pausen müssen sein.
Neutral buoyancy has been used as an analog for microgravity from the earliest days of human spaceflight. Compared to other options on Earth, neutral buoyancy is relatively inexpensive and presents little danger to astronauts while simulating some aspects of microgravity. Neutral buoyancy removes somatosensory cues to the direction of gravity but leaves vestibular cues intact. Removal of both somatosensory and direction of gravity cues while floating in microgravity or using virtual reality to establish conflicts between them has been shown to affect the perception of distance traveled in response to visual motion (vection) and the perception of distance. Does removal of somatosensory cues alone by neutral buoyancy similarly impact these perceptions? During neutral buoyancy we found no significant difference in either perceived distance traveled nor perceived size relative to Earth-normal conditions. This contrasts with differences in linear vection reported between short- and long-duration microgravity and Earth-normal conditions. These results indicate that neutral buoyancy is not an effective analog for microgravity for these perceptual effects.
Cultivation of perennials such as Miscanthus x giganteus Greef et Deuter (Mis) combines the provision of ecosystem services and the generation of additional carbon sources for farming. The potential of Mis based fertilisers, regarding immobilisation of inorganic nitrogen (N) and build-up of soil organic matter (SOM), was tested in a field trial. Therefore, a crop rotation of winter barley (Hordeum vulgare L.), mustard (Sinapis alba L.) as catch crop, sugar beet (Beta vulgaris L.) and winter wheat (Triticum aestivum L.) was set up. The tested treatments were a mixture of Cattle Slurry (CS) and Mis, a mixture of CS and Wheat Straw (CS–WS), Cattle Manure (CM) from Mis shredded bedding, CM from WS shredded bedding, a pure CS, Urea Ammonium Nitrate (UAN) and a treatment without any N applied (NoN). When the carbon-rich fertilisers (both mixtures and manures) were applied to cereals, they led to a slight N immobilisation compared to pure CS, whereas differences were mostly not significant. Furthermore, Mis fertilisers were at least as efficient as WS-based organic fertilisers in inducing a contribution of SOM build-up and in reducing inorganic N before winter and thus preventing N losses, whereas differences were mostly not significant.
Improving the study entry supports students in a decisive phase of their university education. Implementing improvements is a change process and can only be successful if the relevant stakeholders are addressed and convinced. In the described Teaching Quality Pact project evaluation data is used as a mean to discuss in the university the situation of the study programs. As these discussions were based on empirical data rather than on opinion, it was possible to achieve an open discussion about measures that are implemented. The open discussion is maintained during the project when results of the measures taken are analyzed.
Softwareentwickelnde kleine und mittlere Unternehmen (KMU) erkennen zunehmend, dass die nutzerzentrierte Gestaltung ein wichtiges, oft entscheidendes Kriterium für die Benutzerfreundlichkeit und damit den Erfolg ihrer Produkte ist. Stolpersteine auf dem Weg zum erfolgreichen Usability- und User Experience-Engineering sind dabei allerdings häufig die Unkenntnis der passenden Methoden bzw. die Befürchtung zu hohen Aufwands an Ressourcen und von Verzögerungen in der Produktentwicklung (vgl. Stade et al., 2013; Reckin & Brandenburg, 2013; Woywode et al., 2011).
Green infrastructure has been widely recognized for the benefits to human health and biodiversity conservation. However, knowledge of the qualities and requirements of such spaces and structures for the effective delivery of the range of ecosystem services expected is still limited, as well as the identification of trade-offs between services. In this study, we apply the One Health approach in the context of green spaces to investigate how urban park characteristics affect human mental health and wildlife support outcomes and identify synergies and trade-offs between these dimensions. Here we show that perceived restorativeness of park users varies significantly across sites and is mainly affected by safety and naturalness perceptions. In turn, these perceptions are driven by objective indicators of quality, such as maintenance of facilities and vegetation structure, and subjective estimations of biodiversity levels. The presence of water bodies benefited both mental health and wildlife. However, high tree canopy coverage provided greater restoration potential whereas a certain level of habitat heterogeneity was important to support a wider range of bird species requirements. To reconcile human and wildlife needs in green spaces, cities should strategically implement a heterogeneous green infrastructure network that considers trade-offs and maximizes synergies between these dimensions.
Agricultural activities within the city boundaries have a long history in both developed and developing countries. Especially in developing countries these activities contribute to food security and the mitigation of malnutrition (food grown for home consumption). They generate additional income and contribute to recreation, environmental health as well as social interaction. In this paper, a broad approach of Urban AgriCulture is used, which includes the production of crops in urban and peri-urban areas and ranges in developed countries from allotment gardens (Schrebergarten) over community gardens (Urban Gardening) to semi-entrepreneurial self-harvest farms and fully commercialized agriculture (Urban Farming). Citizens seek to make a shift from traditional to new (sustainable) forms of food supply. From this evolves a demand for urban spaces that can be used agriculturally. The way how these citizens’ initiatives can be supported and their contribution to a resilient and sustainable urban food system increasingly attracts attention. This paper presents an empirical case study on Urban AgriCulture initiatives in the Bonn-Rhein-Sieg region (Germany). Urban AgriCulture is still a niche movement with the potential to contribute more significantly to urban development and constitute a pillar of urban quality of life.
Agricultural activities within city boundaries have a long history in both developed and developing countries. In this paper, a broad approach to Urban AgriCulture (UAC) is used, one that includes the production of crops in urban and peri-urban areas and ranges in developed countries from allotment gardens over community gardens to semi-entrepreneurial self-harvest farms and fully commercialized agriculture. With an empirical case study on UAC Initiatives in the Bonn/Rhein-Sieg region this work fills a gap since the lack of comprehensive and comparative studies on urban agriculture (UA) currently makes it difficult for researchers to identify the benefits of UA activities.
In der vorliegenden Arbeit wurde Kraft-Lignin als Makromonomer für die Synthese von thermoplastischen Polyurethanen mit hoher molarer Masse durch acide Präzipitation aus Schwarzlauge isoliert. Die Charakterisierung des Rohstoffes bezüglich seiner Ausgangsmolmasse erfolgte mittels Gel-Permeations-Chromatographie mit Polystyren-Polymerstandard, welche sich als sehr hilfreiche Analysemethode erwies. Da das Kraft-Lignin die klassische Polyolkomponente bei der Synthese von Polyurethanen ersetzen sollte, war es notwendig, den Hydroxylgehalt des Kraft-Lignins zu bestimmen. Für diesen Zweck wurde eine bereits etablierte Prozedur zur nasschemischen Bestimmung des Hydroxylgehaltes von Polyolen für die Synthese von Polyurethanen einer Adaption unterzogen. Es wurde die Reaktionsdauer bei der Acetylierung des Kraft-Lignins variiert. Das Ergebnis war, dass die Messgenauigkeit durch eine Erhöhung der Reaktionsdauer von 1 h auf 3 h drastisch von 25,5 % auf 3,6 % reduziert werden konnte. Um abschätzen zu können, ob die erzielte Messgenauigkeit im Rahmen einer nasschemischen Prozedur mit manueller Titration liegt, wurden zusätzlich die Hydroxylgehalte von Ethandiol und Saccharose bestimmt. Diese dienten als Referenzsubstanz mit definierten und bekannten Hydroxylgehalten. Die Ermittlung der Hydroxylgehalte mit diesen Substanzen ergab für Ethandiol eine Messgenauigkeit von 2,2 % und für Saccharose eine Messgenauigkeit von 1,4 %. Eine Messgenauigkeit von 3,6 % ist in Anbetracht des Zeitaufwandes akzeptabel.
Für die Synthese von thermoplastischen Polyurethanen wurde Kraft-Lignin mit Methylendiphenyldiisocyanat in Dimethylacetamid mit Zinnoktoat als Katalysator zur Reaktion gebracht. Es wurde das NCO/OH-Verhältnis und die Reaktionsdauer variiert. Die Analyse der synthetisierten Polyurethane erfolgte mittels Ubbelohde-Kapillarviskosimetrie, Fourier-Transformations-Infrarotspektroskopie und Schmelzpunktbestimmung. Die FTIR-Spektren bestätigte eine erfolgreiche Synthese von Polyurethanen aus Kraft-Lignin und Methylendiphenyldiisocyanat und zeigte, dass die Variation des NCO/OH-Verhältnisses und der Reaktionsdauer keinerlei Einflüsse auf die chemische Grundstruktur des Polyurethans hat. Die Ubbelohde-Kapillarviskosimetrie belegte die thermoplastischen Eigenschaften des synthetisierten Polyurethans, die sich in einem thermoplastischen Nassprozess verarbeiten lassen. Sie zeigte auch die Abhängigkeit der Molmasse der synthetisierten Polyurethane von der Reaktionsdauer und vom NCO/OH-Verhältnis. So steigt die Molmasse des Polyurethans mit steigender Reaktionsdauer und sinkendem NCO/OH-Verhältnis. Letztere Beobachtung ist sogar praktisch hinsichtlich der gesundheitsgefährdenden Eigenschaft von Isocyanaten, da so der Einsatz von Isocyanaten reduziert werden kann. Um die schmelzflüssige Verarbeitbarkeit des synthetisierten Polyurethans zu untersuchen, wurden die Schmelzpunkte der Polymere bestimmt. Es konnte in einem Temperaturbereich von 25 °C-410 °C keine Aggregatzustandsänderung, sondern lediglich eine Zersetzungsreaktion beobachtet werden.
In dieser vorliegenden Arbeit wurde der photolytische und photokatalytische Abbau von Lignin untersucht. Eine Charakterisierung des verwendeten Photoreaktors wurde mittels Kalium-Ferrioxalat-Aktinometrie durchgeführt. Zur Analyse der abgebauten Lignine wurde eine Optimierung einer bereits bestehenden Methode zur Bestimmung des Hydroxylgehaltes erarbeitet. Die Bestimmung der Hydroxylgehalte erfolgte demnach bei Raumtemperatur nach einer Acetylierungsdauer von 72 h und zeigte eine Abnahme der Hydroxylgehalte mit andauernder UV-Bestrahlung. Selbige Beobachtung konnte mit Hilfe der ATR-IR-Spektroskopie gemacht werden. Zusätzlich konnte die Bildung von Carbonsäuren und der Abbau von aromatischen Strukturen detektiert werden. Der Abbau aromatischer Strukturen konnte ebenfalls durch UV-VIS-Spektroskopie gezeigt werden. Eine Vermutung, dass es sich bei dem Abbauprozess um einen oxidativen Mechanismus handelt, konnte mit dem Abbau von Hydroxylgruppen über eine Bildung von Carbonsäuren zu Kohlenstoffdioxid bestätigt werden. Eine Freisetzung von Kohlenstoffdioxid konnte durch eine Bestimmung des IC festgestellt werden. Die Ergebnisse der Gel-Permeations-Chromatographie zusammen mit einer TOC-Analyse zeigen einen Abbau der molaren Masse des Lignins auf. Es konnten Fragmente mit einer Molmasse ähnlich der Monomere des Lignins gefunden werden. Der eingesetzte Photokatalysator wurde via Röntgenbeugung untersucht und konnte als das hoch photokatalytisch aktive P25 von Degussa identifiziert werden. Trotz des Einsatzes verschiedener Katalysatorkonzentrationen in einem Bereich von 0-0,5 g L^(-1) konnte kein Einfluss des Photokatalysators auf den Abbauprozess des Lignins beobachtet werden.
Diese Arbeit beschäftigt sich mit der Entwicklung eines, für die kontrollierte Freisetzung hydrophiler Wirkstoffe geeigneten, Verkapselungssystems mit dem Ziel die Freisetzung osteospezifischer P2-Liganden zu verzögern, um bei der Behandlung von Knochendefekten kritischer Größe die Bildung neuen Knochengewebes zu gewährleisten. Hierfür werden, unter Anwendung der immersiven Layer-by-Layer-Beschichtung, mit den Modell-Substanzen Adenosintriphosphat und Suramin versetzte, Alginat sowie κ-Carrageen-Kapseln mit Chitosan und Lignosulfonat beschichtet und auf ihr Freisetzungsverhalten hin untersucht.
Im Rahmen der Arbeit wurde Kraft-Lignin mit Natriumsulfit demethyliert, um den Gehalt an aromatischen Hydroxygruppen zu erhöhen und damit die Reaktivität des Lignins in Bezug auf Polyurethan-Synthesen zu erhöhen. Variiert wurden die Demethylierungstemperatur (72°C, 90°C) sowie der pH-Wert zur Isolierung des Kraft-Lignins (pH 2, 3, 4 und 5). Die Analyse der demethylierten Proben erfolgte mittels differentieller UV-Spektroskopie und der OH-Gehaltbestimmung via automatischer Titration (angelehnt an ISO 14900:2001(E)). Weitere Untersuchungen umfassten Löslichkeitstests sowie Strukturanalysen via FTIR- und UV/Vis-Spektroskopie.
Die Wahrnehmung des perzeptionellen Aufrecht (perceptual upright, PU) variiert in Abhängigkeit der Gewichtung verschiedener gravitationsbezogener und körperbasierter Merkmale zwischen Kontexten und aufgrund individueller Unterschiede. Ziel des Vorhabens war es, systematisch zu untersuchen, welche Zusammenhänge zwischen visuellen und gravitationsbedingten Merkmalen bestehen. Das Vorhaben baute auf vorangegangen Untersuchungen auf, deren Ergebnisse indizieren, dass eine Gravitation von ca. 0,15g notwendig ist, um effiziente Selbstorientierungsinformationen bereit zu stellen (Herpers et. al, 2015; Harris et. al, 2014).
In dem hier beschriebenen Vorhaben wurden nun gezielt künstliche Gravitationsbedingungen berücksichtigt, um die Gravitationsschwelle, ab der ein wahrnehmbarer Einfluss beobachtbar ist, genauer zu quantifizieren bzw. die oben genannte Hypothese zu bestätigen. Es konnte gezeigt werden, dass die zentripetale Kraft, die auf einer rotierenden Zentrifuge entlang der Längsachse des Körpers wirkt, genauso efektiv wie Stehen mit normaler Schwerkraft ist, um das Gefühl des perzeptionellen Aufrechts auszulösen. Die erzielten Daten deuten zudem darauf hin, dass ein Gravitationsfeld von mindestens 0,15 g notwendig ist, um eine efektive Orientierungsinformation für die Wahrnehmung von Aufrecht zu liefern. Dies entspricht in etwa der Gravitationskraft von 0,17 g, die auf dem Mond besteht. Für eine lineare Beschleunigung des Körpers liegt der vestibulare Schwellenwert bei etwa 0,1 m/s2 und somit liegt der Wert für die Situation auf dem Mond von 1,6 m/s2 deutlich über diesem Schwellenwert.
Battery lifespan estimation is essential for effective battery management systems, aiding users and manufacturers in strategic planning. However, accurately estimating battery capacity is complex, owing to diverse capacity fading phenomena tied to factors such as temperature, charge-discharge rate, and rest period duration. In this work, we present an innovative approach that integrates real-world driving behaviors into cyclic testing. Unlike conventional methods that lack rest periods and involve fixed charge-discharge rates, our approach involves 1000 unique test cycles tailored to specific objectives and applications, capturing the nuanced effects of temperature, charge-discharge rate, and rest duration on capacity fading. This yields comprehensive insights into cell-level battery degradation, unveiling growth patterns of the solid electrolyte interface (SEI) layer and lithium plating, influenced by cyclic test parameters. The results yield critical empirical relations for evaluating capacity fading under specific testing conditions.
The actomyosin system generates mechanical work with the execution of the power stroke, an ATP-driven, two-step rotational swing of the myosin-neck that occurs post ATP hydrolysis during the transition from weakly to strongly actin-bound myosin states concomitant with Pi release and prior to ADP dissociation. The activating role of actin on product release and force generation is well documented; however, the communication paths associated with weak-to-strong transitions are poorly characterized. With the aid of mutant analyses based on kinetic investigations and simulations, we identified the W-helix as an important hub coupling the structural changes of switch elements during ATP hydrolysis to temporally controlled interactions with actin that are passed to the central transducer and converter. Disturbing the W-helix/transducer pathway increased actin-activated ATP turnover and reduced motor performance as a consequence of prolonged duration of the strongly actin-attached states. Actin-triggered Pi release was accelerated, while ADP release considerably decelerated, both limiting maximum ATPase, thus transforming myosin-2 into a high-duty-ratio motor. This kinetic signature of the mutant allowed us to define the fractional occupancies of intermediate states during the ATPase cycle providing evidence that myosin populates a cleft-closure state of strong actin interaction during the weak-to-strong transition with bound hydrolysis products before accomplishing the power stroke.
Polyurethane (PU) coatings were successfully produced using unmodified kraft lignin (KL) as an environmentally benign component in contents of up to 80 wt%. Lignin samples were precipitated from industrial black liquor in aqueous solution working at room temperature and different pH levels (pH 2 to pH 5). Lignins were characterized by UV-Vis, FTIR, pyrolysis-GC/MS, SEC and 31P-NMR. Results show a correlation between pH level, OH number and molecular weight Mw of isolated lignins. Lignin-based polyurethane coatings were prepared in an efficient one step synthesis dissolving lignin in THF and PEG425 in an ultrasonic bath followed by addition of 4,4-diphenylmethanediisocyanate (MDI) and triethylamine (TEA). Crosslinking was achieved under very mild conditions (1 hour at room temperature followed by 3 hours at 35 °C). The resulting coatings were characterized regarding their physical properties including ATR-IR, TGA, optical contact angle, light microscopy, REM-EDX and AFM data. Transparent homogeneous films of high flexibility resulted from lignins isolated at pH 4, possessing a temperature resistance up to 160 °C. Swelling tests revealed a resistance against water. Swelling in DMSO depends on index, pH of precipitation and catalyst utilization for PU preparation. According to AFM studies, surface roughness is between 10 and 28 nm.
Unlimited paid time off policies are currently fashionable and widely discussed by HR professionals around the globe. While on the one hand, paid time off is considered a key benefit by employees and unlimited paid time off policies (UPTO) are seen as a major perk which may help in recruiting and retaining talented employees, on the other hand, early adopters reported that employees took less time off than previously, presumably leading to higher burnout rates. In this conceptual review, we discuss the theoretical and empirical evidence regarding the potential effects of UPTO on leave utilization, well-being and performance outcomes. We start out by defining UPTO and placing it in a historical and international perspective. Next, we discuss the key role of leave utilization in translating UPTO into concrete actions. The core of our article constitutes the description of the effects of UPTO and the two pathways through which these effects are assumed to unfold: autonomy need satisfaction and detrimental social processes. We moreover discuss the boundary conditions which facilitate or inhibit the successful utilization of UPTO on individual, team, and organizational level. In reviewing the literature from different fields and integrating existing theories, we arrive at a conceptual model and five propositions, which can guide future research on UPTO. We conclude with a discussion of the theoretical and societal implications of UPTO.
Multidisciplinary, multicultural, and multitasking has taken center stage in the global educational debate. Globalization and improvement in communication have affected the way organisations operate and hence influenced whom they hire. Today, it is common practice to work with people from diverse backgrounds and it requires competencies that go beyond general project management. Intercultural awareness, networking in different global communities, and learning to develop specific communication strategies for different stakeholders is all part of the package of skills and competencies that are required in today's interconnected world. This has indirect implication on the nature of skills and competencies institutions/universities must equip their students with to enable them to compete successfully in the working world.
Universities, Entrepreneurship and Enterprise Development in Africa – Conference Proceedings 2022
(2023)
These proceedings are the outcome of the 10th annual joint conference on "Universities Entrepreneurship and Enterprise Development in Africa".
These proceedings document the culmination of the 10th annual joint conference on "Universities, Entrepreneurship and Enterprise Development in Africa," which was held on the 8th and 9th of September 2022 at the Campus Sankt Augustin, Hochschule Bonn-Rhein-Sieg University of Applied Sciences. The conference was a collaboration between the University of Cape Coast, Ghana, and Hochschule Bonn-Rhein-Sieg University of Applied Sciences, Germany.
Universities, Entrepreneurship and Enterprise Development in Africa – Conference Proceedings 2020
(2021)
These proceedings are the outcome of the 8th annual joint conference on "Universities Entrepreneurship and Enterprise Development in Africa" between the University of Cape Coast, Ghana and Hochschule Bonn-Rhein-Sieg University of Applied Sciences, Germany, held on 19-20 February 2020 on Campus Sankt Augustin, Hochschule Bonn-Rhein-Sieg University of Applied Sciences.
Universities, Entrepreneurship and Enterprise Development in Africa – Conference Proceedings 2016
(2017)
These proceedings are the outcome of the 5th annual joint conference on “Universities Entrepreneurship and Enterprise Development in Africa” between the University of Nairobi, Kenya, the University of Cape Coast, Ghana, and Bonn-Rhein-Sieg University of Applied Sciences, Germany, held on 10-11 November 2016 on Campus Sankt Augustin, Bonn-Rhein-Sieg University of Applied Sciences.
Higher Education Institutions (HEIs) should, on the one hand, provide theoretical and practical knowledge to students and, on the other hand, make valuable contributions to theoretical knowledge and provide new insights by means of research. However, HEIs have to face changing and increasing demands with respect to what they are expected to achieve. Education and research issues are no longer enough, what matters today is the so called “third mission”. A specific example for implementing a third mission is the cooperation between HEIs and business incubators. With this in mind, a local consortium consisting of regional HEIs, e.g. Bonn-Rhein-Sieg University of Applied Sciences, as well as public and private institutions and partners initiated and established an incubator hub for the region Bonn/Rhein-Sieg in 2016, called “Digital Hub Region Bonn”. This conference contribution reports on our experience with regards to this cooperation approach resulting from the above- mentioned case. Furthermore the pros and cons as well as some issues of this kind of cooperation will be discussed. Last but not least this paper initiates the opportunity to share and compare the experiences of other university business incubators in Africa as well as in Germany. As we will describe, the financial investment of HEIs in a joint-incubator with other public as well as private partners offers substantial benefits, such as mutual know-how transfer from HEIs to the economy and vice versa. This strengthens entrepreneurial mindsets and activities and contributes to the development and growth of the local economy. Consequently, this cooperation sometimes creates challenges at various levels, for example due to differing interests between HEIs and business partners. This conference contribution offers approaches to solve these issues and to support private public partnership in business incubation.
Innovations in the mobility industry such as automated and connected cars could significantly reduce congestion and emissions by allowing the traffic to flow more freely and reducing the number of vehicles according to some researchers. However, the effectiveness of these sustainable product and service innovations is often limited by unexpected changes in consumption: some researchers thus hypothesize that the higher comfort and improved quality of time in driverless cars could lead to an increase in demand for driving with autonomous vehicles. So far, there is a lack of empirical evidence supporting either one or other of these hypotheses. To analyze the influence of autonomous driving on mobility behavior and to uncover user preferences, which serve as indicators for future travel mode choices, we conducted an online survey with a paired comparison of current and future travel modes with 302 participants in Germany. The results do not confirm the hypothesis that ownership will become an outdated model in the future. Instead they suggest that private cars, whether conventional or fully automated, will remain the preferred travel mode. At the same time, carsharing will benefit from full automation more than private cars. However, the findings indicate that the growth of carsharing will mainly be at the expense of public transport, showing that more emphasis should be placed in making public transport more attractive if sustainable mobility is to be developed.
Political economic analyses of recent social protection reforms in Asian, African or Latin American countries have increased throughout the last few years. Yet, most contributions focus on one social protection mechanism only and do not provide a comparative approach across policy areas. In addition, most studies are empirical studies, with no or very limited theoretical linkages. The paper aims to explain multiple trajectories of social protection reform processes looking at cash transfers and social health protection policies in Kenya. It develops a taxonomy and suggest a conceptual framework to assess and explain reform dynamics across different social protection pillars. In order to allow for a more differentiated typology and enable us to understand different reform dynamics, the article uses the approach on gradual institutional change. While existing approaches to institutional change mostly focus on institutional change prompted by exogenous shocks or environmental shifts, this approach takes account of both, exogenous and endogenous sources of change.
The development of metals tailored to the metallurgical conditions of laser-based additive manufacturing is crucial to advance the maturity of these materials for their use in structural applications. While efforts in this regard are being carried out around the globe, the use of high strength eutectic alloys have, so far, received minor attention, although previous works showed that rapid solidification techniques can result in ultrafine microstructures with excellent mechanical performance, albeit for small sample sizes. In the present work, a eutectic Ti-32.5Fe alloy has been produced by laser powder bed fusion aiming at exploiting rapid solidification and the capability to produce bulk ultrafine microstructures provided by this processing technique.
Process energy densities between 160 J/mm³ and 180 J/mm³ resulted in a dense and crack-free material with an oxygen content of ~ 0.45 wt.% in which a hierarchical microstructure is formed by µm-sized η-Ti4Fe2Ox dendrites embedded in an ultrafine eutectic β-Ti/TiFe matrix. The microstructure was studied three-dimensionally using near-field synchrotron ptychographic X-ray computed tomography with an actual spatial resolution down to 39 nm to analyse the morphology of the eutectic and dendritic structures as well as to quantify their mass density, size and distribution. Inter-lamellar spacings down to ~ 30–50 nm were achieved, revealing the potential of laser-based additive manufacturing to generate microstructures smaller than those obtained by classical rapid solidification techniques for bulk materials. The alloy was deformed at 600 °C under compressive loading up to a strain of ~ 30% without damage formation, resulting in a compressive yield stress of ~ 800 MPa.
This study provides a first demonstration of the feasibility to produce eutectic Ti-Fe alloys with ultrafine microstructures by laser powder bed fusion that are suitable for structural applications at elevated temperature.
The epithelial sodium channel (ENaC) plays a key role in salt and water homeostasis in tetrapod vertebrates. There are four ENaC subunits (α, β, γ, δ), forming heterotrimeric αβγ- or δβγ-ENaCs. While the physiology of αβγ-ENaC is well understood, for decades the field has stalled with respect to δβγ-ENaC due to the lack of mammalian model organisms. The SCNN1D gene coding for δ-ENaC was previously believed to be absent in rodents, hindering studies using standard laboratory animals. We analysed all currently available rodent genomes and discovered that SCNN1D is present in rodents but was independently lost in five rodent lineages, including the Muridae (mice and rats). The independent loss of SCNN1D in rodent lineages may be constrained by phylogeny and taxon-specific adaptation to dry habitats, however habitat aridity does not provide a selection pressure for maintenance of SCNN1D across Rodentia. A fusion of two exons coding for a structurally flexible region in the extracellular domain of δ-ENaC appeared in the Hystricognathi (a group that includes guinea pigs). This conserved pattern evolved at least 41 Ma ago and represents a new autapomorphic feature for this clade. Exon fusion does not impair functionality of guinea pig (Cavia porcellus) δβγ-ENaC expressed in Xenopus oocytes. Electrophysiological characterisation at the whole-cell and single-channel level revealed conserved biophysical features and mechanisms controlling guinea pig αβγ- and δβγ-ENaC function as compared to human orthologues. Guinea pigs therefore represent commercially available mammalian model animals that will help shed light on the physiological function of δ-ENaC.
Development of colored surfaces by formation of nano-structured aggregates is a widely used strategy in nature to color lightweight structures (e.g. butterflies) without the use of dye pigments. The deposition of nanoscale particles mimics nature in it’s approach coloring surfaces. This work presents sol-gel modification of cellulose surfaces used to form a template for growth of Cu/Cu2O core-shell particles with defined size-distributions. Besides improving the adhesion of the deposited particulate material, the sol-gel matrix serves as a template for the control of particle sizes of the Cu/Cu2O structures, and as a consequence of particle size variation the surface color is tunable. As an example, red color was achieved with an average particle size of 35 nm, and shifts gradually to blue appearance when particles have grown to 80 nm on the sol-gel modified fabric. The copper concentration on representative fabrics is kept low to avoid modifying the textile characteristics and were all in the range of 150–170 mg per g of cellulose material. As a result of copper deposition on the surface of the material, the cellulose fabric also became electrically conductive. Remarkably, the electrical conductivity was found to be dependent on the average particle sizes of the deposits and thus related to the change in observed color. The generation of color by growth of nano-sized particles on sol-gel templates provides a highly promising approach to stain surfaces by physical effects without use of synthetic colorants, which opens a new strategy to improve environmental profile of coloration.
Trust-Building in Peer-to-Peer Carsharing: Design Case Study for Algorithm-Based Reputation Systems
(2023)
Peer-to-peer sharing platforms become increasingly important in the platform economy. From an HCI-perspective, this development is of high interest, as those platforms mediate between different users. Such mediation entails dealing with various social issues, e.g., building trust between peers online without any physical presence. Peer ratings have proven to be an important mechanism in this regard. At the same time, scoring via car telematics become more common for risk assessment by car insurances. Since user ratings face crucial problems such as fake or biased ratings, we conducted a design case study to determine whether algorithm-based scoring has the potential to improve trust-building in P2P-carsharing. We started with 16 problem-centered interviews to examine how people understand algorithm-based scoring, we co-designed an app with scored profiles, and finally evaluated it with 12 participants. Our findings show that scoring systems can support trust-building in P2P-carsharing and give insights how they should be designed.
Trust your guts: fostering embodied knowledge and sustainable practices through voice interaction
(2023)
Despite various attempts to prevent food waste and motivate conscious food handling, household members find it difficult to correctly assess the edibility of food. With the rise of ambient voice assistants, we did a design case study to support households’ in situ decision-making process in collaboration with our voice agent prototype, Fischer Fritz. Therefore, we conducted 15 contextual inquiries to understand food practices at home. Furthermore, we interviewed six fish experts to inform the design of our voice agent on how to guide consumers and teach food literacy. Finally, we created a prototype and discussed with 15 consumers its impact and capability to convey embodied knowledge to the human that is engaged as sensor. Our design research goes beyond current Human-Food Interaction automation approaches by emphasizing the human-food relationship in technology design and demonstrating future complementary human-agent collaboration with the aim to increase humans’ competence to sense, think, and act.
The non-filarial and non-communicable disease podoconiosis affects around 4 million people and is characterized by severe leg lymphedema accompanied with painful intermittent acute inflammatory episodes, called acute dermatolymphangioadenitis (ADLA) attacks. Risk factors have been associated with the disease but the mechanisms of pathophysiology remain uncertain. Lymphedema can lead to skin lesions, which can serve as entry points for bacteria that may cause ADLA attacks leading to progression of the lymphedema. However, the microbiome of the skin of affected legs from podoconiosis individuals remains unclear. Thus, we analysed the skin microbiome of podoconiosis legs using next generation sequencing. We revealed a positive correlation between increasing lymphedema severity and non-commensal anaerobic bacteria, especially Anaerococcus provencensis, as well as a negative correlation with the presence of Corynebacterium, a constituent of normal skin flora. Disease symptoms were generally linked to higher microbial diversity and richness, which deviated from the normal composition of the skin. These findings show an association of distinct bacterial taxa with lymphedema stages, highlighting the important role of bacteria for the pathogenesis of podoconiosis and might enable a selection of better treatment regimens to manage ADLA attacks and disease progression.
Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC50 of 50 μM. The binding motif can influence the activity of Hsp90 by hindering ATP accessibility or the release of ADP.
It is challenging to provide users with a haptic weight sensation of virtual objects in VR since current consumer VR controllers and software-based approaches such as pseudo-haptics cannot render appropriate haptic stimuli. To overcome these limitations, we developed a haptic VR controller named Triggermuscle that adjusts its trigger resistance according to the weight of a virtual object. Therefore, users need to adapt their index finger force to grab objects of different virtual weights. Dynamic and continuous adjustment is enabled by a spring mechanism inside the casing of an HTC Vive controller. In two user studies, we explored the effect on weight perception and found large differences between participants for sensing change in trigger resistance and thus for discriminating virtual weights. The variations were easily distinguished and associated with weight by some participants while others did not notice them at all. We discuss possible limitations, confounding factors, how to overcome them in future research and the pros and cons of this novel technology.