Refine
H-BRS Bibliography
- yes (476) (remove)
Departments, institutes and facilities
- Institut für Technik, Ressourcenschonung und Energieeffizienz (TREE) (476) (remove)
Document Type
- Conference Object (216)
- Article (173)
- Part of a Book (26)
- Preprint (17)
- Report (11)
- Doctoral Thesis (8)
- Contribution to a Periodical (6)
- Research Data (6)
- Book (monograph, edited volume) (4)
- Part of Periodical (4)
Year of publication
Keywords
- lignin (7)
- Quality diversity (6)
- West Africa (6)
- advanced applications (5)
- modeling of complex systems (5)
- stem cells (5)
- Hydrogen storage (4)
- Lattice Boltzmann Method (4)
- Lignin (4)
- additive (4)
Bionik
(2022)
Wie machen die das… kann angesichts der erstaunlichen Fähigkeiten mancher Lebewesen gefragt werden. Die Bionik fragt noch weiter …und wie kann man das nachmachen? Hier liegt ein Schwerpunkt dieses Lehrbuches, das die Bionik nicht nur an zahlreichen Beispielen erklärt, sondern auch eine Vorgehensweise für die Identifizierung biologischer Lösungen und deren Übertragung auf technische Anwendungen vermittelt. Basisinformationen der Biologie und Grundlagen der Konstruktionstechnik gewährleisten einen leichten Zugang zum Stoff. Mit dem 3D-Druck als Schlüsseltechnologie und der Thematisierung der Nachhaltigkeit geht das Buch zudem auf aktuelle Entwicklungen ein. Dieser ganzheitliche Blick auf die Bionik soll den Leser zur Durchführung bionischer Projekte befähigen und motivieren. Die vorliegende Auflage wurde überarbeitet und um aktuelle Forschungserkenntnisse und Entwicklungen ergänzt. (Verlagsangaben)
This paper investigates the effect of voltage sensors on the measurement of transient voltages for power semiconductors in a Double Pulse Test (DPT) environment.We adapt previously published models that were developed for current sensors and apply them to voltage sensors to evaluate their suitability for DPT applications. Similarities and differences between transient current and voltage sensors are investigated and the resulting methodology is applied to commercially available and experimental voltage sensors. Finally, a selection aid for given measurement tasks is derived that focuses on the measurement of fast-switching power semiconductors.
Sie sind im Bereich Qualitätsmanagement tätig und haben die Aufgabe bekommen, ein Problem systematisch zu untersuchen und methodisch zu lösen? Sie haben zu viele Aufgaben und wissen nicht, wie Sie diese priorisieren sollen? Oder haben Sie zu begrenzte Ressourcen, um alle Reklamationen gleichzeitig bearbeiten zu können? Oder wissen nicht, wie Sie einen bestimmten Prozess in seinen Grenzen zielführend verbessern können?
While many proteins are known clients of heat shock protein 90 (Hsp90), it is unclear whether the transcription factor, thyroid hormone receptor beta (TRb), interacts with Hsp90 to control hormonal perception and signaling. Higher Hsp90 expression in mouse fibroblasts was elicited by the addition of triiodothyronine (T3). T3 bound to Hsp90 and enhanced adenosine triphosphate (ATP) binding of Hsp90 due to a specific binding site for T3, as identified by molecular docking experiments. The binding of TRb to Hsp90 was prevented by T3 or by the thyroid mimetic sobetirome. Purified recombinant TRb trapped Hsp90 from cell lysate or purified Hsp90 in pull-down experiments. The affinity of Hsp90 for TRb was 124 nM. Furthermore, T3 induced the release of bound TRb from Hsp90, which was shown by streptavidin-conjugated quantum dot (SAv-QD) masking assay. The data indicate that the T3 interaction with TRb and Hsp90 may be an amplifier of the cellular stress response by blocking Hsp90 activity.
Approximately 45% of global greenhouse gas emissions are caused by the construction and use of buildings. Thermal insulation of buildings in the current context of climate change is a well-known strategy to improve the energy efficiency of buildings. The development of renewable insulation material can overcome the drawbacks of widely used insulation systems based on polystyrene or mineral wool. This study analyzes the sustainability and thermal conductivity of new insulation materials made of Miscanthus x giganteus fibers, foaming agents, and alkali-activated fly ash binder. Life cycle assessments (LCA) are necessary to perform benchmarking of environmental impacts of new formulations of geopolymer-based insulation materials. The global warming potential (GWP) of the product is primarily determined by the main binder component sodium silicate. Sodium silicate's CO2 emissions depend on local production, transportation, and energy consumption. The results, which have been published during recent years, vary in a wide range from 0.3 kg to 3.3 kg CO2-eq. kg-1. The overall GWP of the insulation system based on Miscanthus fibers, with properties according to current thermal insulation regulations, reaches up to 95% savings of CO2 emissions compared to conventional systems. Carbon neutrality can be achieved through formulations containing raw materials with carbon dioxide emissions and renewable materials with negative GWP, thus balancing CO2 emissions.
In her recent article, Bender discusses several aspects of research–practice–collaborations (RPCs). In this commentary, we apply Bender's arguments to experiences in engineering research and development (R&D). We investigate the influence of interaction with practice partners on relevance, credibility, and legitimacy in the special engineering field of product development and analyze which methodological approaches are already being pursued for dealing with diverging interests and asymmetries and which steps will be necessary to include interests of civil society beyond traditional customer relations.
This paper explores the role of artificial intelligence (AI) in elite sports. We approach the topic from two perspectives. Firstly, we provide a literature based overview of AI success stories in areas other than sports. We identified multiple approaches in the area of Machine Perception, Machine Learning and Modeling, Planning and Optimization as well as Interaction and Intervention, holding a potential for improving training and competition. Secondly, we discover the present status of AI use in elite sports. Therefore, in addition to another literature review, we interviewed leading sports scientist, which are closely connected to the main national service institute for elite sports in their countries. The analysis of this literature review and the interviews show that the most activity is carried out in the methodical categories of signal and image processing. However, projects in the field of modeling & planning have become increasingly popular within the last years. Based on these two perspectives, we extract deficits, issues and opportunities and summarize them in six key challenges faced by the sports analytics community. These challenges include data collection, controllability of an AI by the practitioners and explainability of AI results.
In this paper, an analysis of the error ellipsoid in the space of solutions of stationary gas transport problems is carried out. For this purpose, a Principal Component Analysis of the solution set has been performed. The presence of unstable directions is shown associated with the marginal fulfillment of the resistivity conditions for the equations of compressors and other control elements in gas networks. Practically, the instabilities occur when multiple compressors or regulators try to control pressures or flows in the same part of the network. Such problems can occur, in particular, when the compressors or regulators reach their working limits. Possible ways of resolving instabilities are considered.
Introduction of Matrix-Filler Adhesion to Modelling of Elastic Moduli of Particulate Composites
(2022)
Cube in cube elementary volume (EV) concept serves to predict a filler-content dependent Young´s moduli of particle filled composites using moduli of a matrix EM and a filler EF. Paul and Ishai-Cohen derived formulas for composites moduli considering different load transfer boundaries in the EV assuming a complete filler-matrix adhesion. In this paper it is confirmed that their models represent the upper and lower bounds, respectively, with the respect to the experimental data. However, in vast majority of composites a filler-matrix adhesion is not complete. Therefore, an adhesion factor kadh gaining values between 0 and 1 was introduced into Paul´s model to consider the reduced adhesion as the reduction of the filler-matrix contact area for glass beads filled in polar and unpolar thermoplastic matrices as well as elastomer. The evaluation of these composite systems provides reasonable adhesion coefficients of PA66 > PBT > PP > PE-LD >> BR. It was also found that stiffening only occurs if kadh exceeds the minimum value adhesion of root square of E(M) divided by E(F). The determined kadh correspond to scanning electron microscopy observations of the composites fracture surfaces. Additionally, finite element analysis of the cubic and hexagonal arrangements of the EV show that the stress distributions are different, but they affect the calculated moduli only for the filler volume contents exceeding 20 %. The introduction of the filler-matrix adhesion provides more reliable predictions of Young´s moduli of particulate composites.
This dataset contains data from two measurement campaigns in autumn 2018 and summer 2019 that were part of the BMWi project "MetPVNet", and serve as a supplement to the paper "Dynamic model of photovoltaic module temperature as a function of atmospheric conditions", published in the special edition of "Advances in Science and Research", the proceedings of the 19th EMS Annual Meeting: European Conference for Applied Meteorology and Climatology 2019.
Data are resampled to one minute, and include:
PV module temperature
Ambient temperature
Plane-of-array irradiance
Windspeed
Atmospheric thermal emission
The data were used for the dynamic temperature model, as presented in the paper
The electricity grid of the future will be built on renewable energy sources, which are highly variable and dependent on atmospheric conditions. In power grids with an increasingly high penetration of solar photovoltaics (PV), an accurate knowledge of the incoming solar irradiance is indispensable for grid operation and planning, and reliable irradiance forecasts are thus invaluable for energy system operators. In order to better characterise shortwave solar radiation in time and space, data from PV systems themselves can be used, since the measured power provides information about both irradiance and the optical properties of the atmosphere, in particular the cloud optical depth (COD). Indeed, in the European context with highly variable cloud cover, the cloud fraction and COD are important parameters in determining the irradiance, whereas aerosol effects are only of secondary importance.
Intention: Within the research project EnerSHelF (Energy-Self-Sufficiency for Health Facilities in Ghana), i. a. energy-meteorological and load-related measurement data are collected, for which an overview of the availability is to be presented on a poster.
Context: In Ghana, the total electricity consumed has almost doubled between 2008 and 2018 according to the Energy Commission of Ghana. This goes along with an unstable power grid, resulting in power outages whenever electricity consumption peaks. The blackouts called "dumsor" in Ghana, pose a severe burden to the healthcare sector. Innovative solutions are needed to reduce greenhouse gas emissions and improve energy and health access.
West Africa has great potential for the use of solar energy systems, as it has both a high solar radiation rate and a lack of energy production. West Africa is a very aerosol-rich region, whose effects on photovoltaic (PV) use are due to both atmospheric conditions and existing solar technology. This study reports the variability of aerosol optical properties in the city of Koforidua, Ghana over the period 2016 to 2020, and their impact on the radiation intensity and efficiency of a PV cell. The study used AERONET ground (Giles et al., 2019) and satellite data produced by CAMS (Gschwind, et al., 2019), which both provide aerosol optical depth (AOD) and metrological parameters used for radiative transfer calculations with libRadtran (Emde, et al., 2016). A spectrally resolved PV model (Herman-Czezuch et al., 2022) is then used to calculate the PV yield of two PV technologies: polycrystalline and amorphous silicon. It is observed that for both data sets, the aerosol is mainly composed of dust and organic matter, with a very increased AOD load during the harmattan period (December-February), also due to the fires observed during this period.
The accurate forecasting of solar radiation plays an important role for predictive control applications for energy systems with a high share of photovoltaic (PV) energy. Especially off-grid microgrid applications using predictive control applications can benefit from forecasts with a high temporal resolution to address sudden fluctuations of PV-power. However, cloud formation processes and movements are subject to ongoing research. For now-casting applications, all-sky-imagers (ASI) are used to offer an appropriate forecasting for aforementioned application. Recent research aims to achieve these forecasts via deep learning approaches, either as an image segmentation task to generate a DNI forecast through a cloud vectoring approach to translate the DNI to a GHI with ground-based measurement (Fabel et al., 2022; Nouri et al., 2021), or as an end-to-end regression task to generate a GHI forecast directly from the images (Paletta et al., 2021; Yang et al., 2021). While end-to-end regression might be the more attractive approach for off-grid scenarios, literature reports increased performance compared to smart-persistence but do not show satisfactory forecasting patterns (Paletta et al., 2021). This work takes a step back and investigates the possibility to translate ASI-images to current GHI to deploy the neural network as a feature extractor. An ImageNet pre-trained deep learning model is used to achieve such translation on an openly available dataset by the University of California San Diego (Pedro et al., 2019). The images and measurements were collected in Folsom, California. Results show that the neural network can successfully translate ASI-images to GHI for a variety of cloud situations without the need of any external variables. Extending the neural network to a forecasting task also shows promising forecasting patterns, which shows that the neural network extracts both temporal and momentarily features within the images to generate GHI forecasts.
Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC50 of 50 μM. The binding motif can influence the activity of Hsp90 by hindering ATP accessibility or the release of ADP.
Novel methods for contingency analysis of gas transport networks are presented. They are motivated by the transition of our energy system where hydrogen plays a growing role. The novel methods are based on a specific method for topological reduction and so-called supernodes. Stationary Euler equations with advanced compressor thermodynamics and a gas law allowing for gas compositions with up to 100% hydrogen are used. Several measures and plots support an intuitive comparison and analysis of the results. In particular, it is shown that the newly developed methods can estimate locations and magnitudes of additional capacities (injection, buffering, storage etc.) with a reasonable performance for networks of relevant composition and size.
The design of a fully superconducting wind power generator is influenced by several factors. Among them, a low number of pole pairs is desirable to achieve low AC losses in the superconducting stator winding, which greatly influences the cooling system design and, consecutively, the efficiency of the entire wind power plant. However, it has been identified that a low number of pole pairs in a superconducting generator tends to greatly increase its output voltage, which in turn creates challenging conditions for the necessary power electronic converter. This study highlights the interdependencies between the design of a fully superconducting 10 MW wind power generator and the corresponding design of its power electronic converter.
Process-induced changes in the morphology of biodegradable polybutylene adipate terephthalate (PBAT) and polylactic acid (PLA) blends modified with various multifunctional chainextending cross-linkers (CECLs) are presented. The morphology of unmodified and modified films produced with blown film extrusion is examined in an extrusion direction (ED) and a transverse direction (TD). While FTIR analysis showed only small peak shifts indicating that the CECLs modify the molecular weight of the PBAT/PLA blend, SEM investigations of the fracture surfaces of blown extrusion films revealed their significant effect on the morphology formed during the processing. Due to the combined shear and elongation deformation during blown film extrusion, rather spherical PLA islands were partly transformed into long fibrils, which tended to decay to chains of elliptical islands if cooled slowly. The CECL introduction into the blend changed the thickness of the PLA fibrils, modified the interface adhesion, and altered the deformation behavior of the PBAT matrix from brittle to ductile. The results proved that CECLs react selectively with PBAT, PLA, and their interface. Furthermore, the reactions of CECLs with PBAT/PLA induced by the processing depended on the deformation directions (ED and TD), thus resulting in further non-uniformities of blown extrusion films.
Typically, plastic packaging materials are produced using additives, like e.g. stabilisers, to introduce specific desired properties into the material or, in case of stabilisers, to prolong the shelf life of such packaging materials. However, those stabilisers are typically fossil-based and can pose risks to both environmental and human health. Therefore, the present study presents more sustainable alternatives based on regional renewable resources which show the relevant antioxidant, antimicrobial and UV absorbing properties to successfully serve as a plastic stabiliser. In the study, all plants are extracted and characterised with regard to not only antioxidant, antimicrobial and UV absorbing effects, but also with regard to additional relevant information like chemical constituents, molar mass distribution, absorbance in the visible range et cetera. The extraction process is furthermore optimised and, where applicable, reasonable opportunities for waste valorisation are explored and analysed. Furthermore, interactions between analysed plant extracts are described and model films based on Poly-Lactic Acid are prepared, incorporating analysed plant extracts. Based on those model films, formulation tests and migration analysis according to EU legislation is conducted.
The well-known aromatic and medicinal plant thyme (Thymus vulgaris L.) includes phenolic terpenoids like thymol and carvacrol which have strong antioxidant, antimicrobial and UV absorbing effects. Analyses show that those effects can be used in both lipophilic and hydrophilic surroundings, that the variant Varico 3 is a more potent cultivar than other analysed thyme variants, and that a passive extraction setup can be used for extract preparation while distillation of the Essential Oils can be a more efficient approach.
Macromolecular antioxidant polyphenols, particularly proanthocyanidins, have been found in the seed coats of the European horse chestnut (Aesculus hippocastanum L.) which are regularly discarded in phytopharmaceutical industry. In this study, such effects and compounds have been reported for the first time while a valorisation of waste materials has been analysed successfully. Furthermore, a passive extraction setup for waste materials and whole seeds has been developed. In extracts of snowdrops, precisely Galanthus elwesii HOOK.F., high concentrations of tocopherol have been found which promote a particularly high antioxidant capacity in lipophilic surroundings. Different coniferous woods (Abies div., Picea div.) which are in use as Christmas trees are extracted after separating the biomass in leafs and wood parts before being analysed regarding extraction optimisation and drought resistance of active substances. Antioxidant and UV absorbing proanthocyanidins are found even in dried biomasses, allowing the circular use of already used Christmas trees as bio-based stabilisers and the production of sustainable paper as a byproduct.
Fundamentals of Energy Meteorology - Influence of atmospheric parameters on solar energy production
(2015)
The utilization of simulation procedures is gaining increasing attention in the product development of extrusion blow molded parts. However, some simulation steps, like the simulation of shrinkage and warpage, are still associated with uncertainties. The reason for this is on the one hand a lack of standardized interfaces for the transfer of simulation data between different simulation tools, and on the other hand the complex time-, temperature- and process-dependent material behavior of the used semi crystalline polymers. Using a new vendor neutral interface standard for the data transfer, the shrinkage analysis of a simple blow molded part is investigated and compared to experimental data. A linear viscoelastic material model in combination with an orthotropic process- and temperature-dependent thermal expansion coefficient is used for the shrinkage prediction. A good agreement is observed. Finally, critical parameters in the simulation models that strongly influence the shrinkage analysis are identified by a sensitivity study.
Jet engines of airplanes are designed such that in some components damage occurs and accumulates in service without being critical up to a certain level of damage. Since maintenance, repair, and component exchange are very cost-intensive, it is necessary to predict efficiently the component lifetime with high accuracy. A former developed lifetime model, based on interpolated results of aerodynamic and structural mechanics simulations, uses material parameters estimated from literature values of standard creep experiments. For improved accuracy, an experimental procedure is developed for the characterization of the short-time creep behavior, which is relevant for the operation of turbine blades of jet engines. To consider microstructural influences resulting from the manufacturing of thin-walled single crystal turbine blades, small-scale specimens from used turbine blades are extracted and tested in short- and medium-time creep experiments. Based on experimental results and literature values, a creep model, which describes the fracture behavior for a wide range of creep loads, is calibrated and is now used for the lifetime prediction of turbine blades under real loading conditions.
Characterization methods of pressure sensitive adhesives (PSA) originate from technical bonding and do not cover relevant data for the development and quality assurance of medical applications, where PSA with flexible backing layers are adopted to human skin. In this study, a new method called RheoTack is developed to determine (mechanically and optically) an adhesion and detaching behavior of flexible and transparent PSA based patches. Transdermal therapeutic systems (TTS) consisting of silicone-based PSAs on a flexible and transparent backing layer were tested on a rotational rheometer with an 8 mm plate as a probe rod at retraction speeds of 0.01, 0.1, and 1 mm/s with respect to their adhesion and detaching behavior in terms of force-retraction displacement curves. The curves consist of a compression phase to affirm wetting; a tensile deformation phase intercepting stretching, cavity, and fibril formation; and a failure phase with detaching. Their analysis provides values for stiffness, force, and displacement of the beginning of fibril formation, force and displacement of the beginning of a failure due to fibril breakage and detaching, as well as corresponding activation energies. All these parameters exhibit the pronounced dependency on the retraction speed. The force-retraction displacement curves together with the simultaneous video recordings of the TTS deformation from three different angles (three cameras) provide deeper insight into the deformation processes and allow for interpreting the properties’ characteristics for PSA applications.
Comparing Armature Windings for a 10 MW Fully Superconducting Synchronous Wind Turbine Generator
(2022)
Nur maximal ein Fünftel aller Menschen in Deutschland, die Maschinen entwickeln, technische Innovationen vorantreiben, optimieren oder reparieren, sind weiblich. Der Anteil von Frauen in technischen Berufen liegt derzeit bei etwa 20 Prozent (1). Vergleichbar niedrig ist auch die Zahl der Journalistinnen, die sich technischen Themen verschrieben haben. Technik und auch der Technikjournalismus sind hierzulande immer noch Männerdomänen.
How self-reliant Peer Teaching can be set up to augment learning outcomes for university learners
(2022)
In this paper, a gas-to-power (GtoP) system for power outages is digitally modeled and experimentally developed. The design includes a solid-state hydrogen storage system composed of TiFeMn as a hydride forming alloy (6.7 kg of alloy in five tanks) and an air-cooled fuel cell (maximum power: 1.6 kW). The hydrogen storage system is charged under room temperature and 40 bar of hydrogen pressure, reaching about 110 g of hydrogen capacity. In an emergency use case of the system, hydrogen is supplied to the fuel cell, and the waste heat coming from the exhaust air of the fuel cell is used for the endothermic dehydrogenation reaction of the metal hydride. This GtoP system demonstrates fast, stable, and reliable responses, providing from 149 W to 596 W under different constant as well as dynamic conditions. A comprehensive and novel simulation approach based on a network model is also applied. The developed model is validated under static and dynamic power load scenarios, demonstrating excellent agreement with the experimental results.
In this thesis it is posed that the central object of preference discovery is a co-creative process in which the Other can be represented by a machine. It explores efficient methods to enhance introverted intuition using extraverted intuition's communication lines. Possible implementations of such processes are presented using novel algorithms that perform divergent search to feed the users' intuition with many examples of high quality solutions, allowing them to take influence interactively. The machine feeds and reflects upon human intuition, combining both what is possible and preferred. The machine model and the divergent optimization algorithms are the motor behind this co-creative process, in which machine and users co-create and interactively choose branches of an ad hoc hierarchical decomposition of the solution space.
The proposed co-creative process consists of several elements: a formal model for interactive co-creative processes, evolutionary divergent search, diversity and similarity, data-driven methods to discover diversity, limitations of artificial creative agents, matters of efficiency in behavioral and morphological modeling, visualization, a connection to prototype theory, and methods to allow users to influence artificial creative agents. This thesis helps putting the human back into the design loop in generative AI and optimization.
In this study, we investigate the thermo-mechanical relaxation and crystallization behavior of polyethylene using mesoscale molecular dynamics simulations. Our models specifically mimic constraints that occur in real-life polymer processing: After strong uniaxial stretching of the melt, we quench and release the polymer chains at different loading conditions. These conditions allow for free or hindered shrinkage, respectively. We present the shrinkage and swelling behavior as well as the crystallization kinetics over up to 600 ns simulation time. We are able to precisely evaluate how the interplay of chain length, temperature, local entanglements and orientation of chain segments influences crystallization and relaxation behavior. From our models, we determine the temperature dependent crystallization rate of polyethylene, including crystallization onset temperature.
Introduction: Chronic pain is a frequent severe disease and often associated with anxiety, depression, insomnia, disability, and reduced quality of life. This maladaptive condition is further characterized by sensory loss, hyperalgesia, and allodynia. Blue light has been hypothesized to modulate sensory neurons and thereby influence nociception.
Objectives: Here, we compared the effects of blue light vs red light and thermal control on pain sensation in a human experimental pain model.
Methods: Pain, hyperalgesia, and allodynia were induced in 30 healthy volunteers through high-density transcutaneous electrical stimulation. Subsequently, blue light, red light, or thermal control treatment was applied in a cross-over design. The nonvisual effects of the respective light treatments were examined using a well-established quantitative sensory testing protocol. Somatosensory parameters as well as pain intensity and quality were scored.
Results: Blue light substantially reduced spontaneous pain as assessed by numeric rating scale pain scoring. Similarly, pain quality was significantly altered as assessed by the German counterpart of the McGill Pain Questionnaire. Furthermore, blue light showed antihyperalgesic, antiallodynic, and antihypesthesic effects in contrast to red light or thermal control treatment.
Conclusion: Blue-light phototherapy ameliorates pain intensity and quality in a human experimental pain model and reveals antihyperalgesic, antiallodynic, and antihypesthesic effects. Therefore, blue-light phototherapy may be a novel approach to treat pain in multiple conditions.
In the research project "MetPVNet", both, the forecast-based operation management in distribution grids and as well as the forecasts of the feed-in of PV-power from decentralized plants could be improved on the basis of satellite data and numerical weather forecasts. Based on a detailed network analyses for a real medium-voltage grid area, it was shown that both – the integration of forecast data based on satellite and weather data and the improvement of subsequent day forecasts based on numerical weather models – have a significant added value for forecast-based congestion management or redispatch and reactive power management in the distribution grid. Furthermore, forecast improvements for the forecast model of the German Weather Service were achieved by assimilating visible satellite imagery, and cloud and radiation products from satellites were improved, thus improving the database for short-term forecasting as well as for assimilation. In addition, several methods have been developed that will enable forecast improvement in the future, especially for weather situations with high cloud induced variability and high forecast errors. This article summarizes the most important project results.
Suitability of Current Sensors for the Measurement of Switching Currents in Power Semiconductors
(2021)
This paper investigates the impact of current sensors on the measurement of transient currents in fast-switching power semiconductors in a double pulse test (DPT environment. We review previous research that assesses the influence of current sensors on a DPT circuit through mathematical modeling. The developed selection aids can be used to identify suitable current sensors for transient current measurements of fast-switching power semiconductors and to estimate the error introduced by their insertion into the DPT circuit. Afterwards, this analysis is extended by including further elements from real DPT applications to increase the consistency of the error estimation with practical situations and setups. Both methods are compared and their individual advantages and drawbacks are discussed. Finally, a recommendation on when to use which method is derived.
Animal models are often needed in cancer research but some research questions may be answered with other models, e.g., 3D replicas of patient-specific data, as these mirror the anatomy in more detail. We, therefore, developed a simple eight-step process to fabricate a 3D replica from computer tomography (CT) data using solely open access software and described the method in detail. For evaluation, we performed experiments regarding endoscopic tumor treatment with magnetic nanoparticles by magnetic hyperthermia and local drug release. For this, the magnetic nanoparticles need to be accumulated at the tumor site via a magnetic field trap. Using the developed eight-step process, we printed a replica of a locally advanced pancreatic cancer and used it to find the best position for the magnetic field trap. In addition, we described a method to hold these magnetic field traps stably in place. The results are highly important for the development of endoscopic tumor treatment with magnetic nanoparticles as the handling and the stable positioning of the magnetic field trap at the stomach wall in close proximity to the pancreatic tumor could be defined and practiced. Finally, the detailed description of the workflow and use of open access software allows for a wide range of possible uses.
Different analyses and feasibility studies have been conducted on the plant extracts of thyme (Thymus vulgaris), European horse chestnut (Aesculus hippocastanum), Nordmann fir (Abies nordmanniana), and snowdrop (Galanthus elwesii) to evaluate bio‐based alternatives to common petrol‐based stabilisers. For this purpose, in this study, plant extracts were incorporated into poly‐lactic acid films (PLA) at different concentrations. The films’ UV absorbance and migration into packed food was analysed via photometric assays (ABTS radical cation scavenging capacity assay, β‐carotene assay) and GC–MS analysis. Furthermore, the synergistic antioxidant effects of various combinations of extracts and isolated active compounds were determined. This way, antioxidant effects can be increased, allowing for a highly effective use of resources. All extracts were successfully incorporated into PLA films and showed notable photoabsorbing effects, while no migration risk was observed. Depending on extract combinations, high synergistic effects of up to 726% can be utilised to improve the effectiveness of bio‐based extracts. This applies particularly to tomato paste and Aesculus hippocastanum extracts, which overall show high synergistic and antioxidant effects in combination with each other and with isolated active compounds. The study shows that it is possible to create safe bio‐based antioxidant films which show even improved properties when using highlighted target combinations.
Anhand detaillierter Netzanalysen für ein reales Mittelspannungsnetzgebiet konnte gezeigt werden, dass sowohl die Einbindung von Prognosedaten auf Basis von Satelliten und Wetterdaten, als auch die Verbesserung von Folgetagsprognosen auf der Basis numerischer Wettermodelle einen deutlichen Mehrwert für ein prognosebasiertes Engpassmanagement bzw. Redispatch und Blindleistungsmanagement im Verteilnetz aufweisen. Auch Kurzfristprognosen auf der Basis von Satellitendaten haben einen positiven Effekt. Ein weiterer wichtiger Mehrwert des Projektes ist auch die Rückmeldung der kritischen Prognosesituationen aus Sicht der Anwendungsfälle, so dass wie bereits im Projekt gezeigt und darüber hinaus, Prognosen zielgerichteter auf die Anwendung im Verteilnetzbetrieb ausgelegt und optimiert werden können.
Weiterhin konnten Prognoseverbesserungen für das Vorhersagemodell des Deutschen Wetterdienstes durch die Assimilation von sichtbaren Satellitenbildern erreicht werden. Darüber hinaus wurden Wolken- und Strahlungsprodukte aus Satelliten verbessert und somit die Datenbasis für die Kurzfristprognose als auch für die Assimilation.
Darüber hinaus wurden verschiedene Methoden entwickelt, die zukünftig zu einer weiteren Prognoseverbesserung, insbesondere für Wettersituationen mit hohen Prognosefehlern, führen könnten. Solche Situationen wurden aus Sicht des Netzbetriebs und mithilfe von satellitenbasierten Analysen der Gesamtwetterlage für die Perioden der MetPVNet Messkampagnen identifiziert. Hierbei handelte es sich insbesondere um Situationen mit starker oder stark wechselhafter Bewölkung.
Für die MetPVNet Messkampagnen wurde auf der Basis eines Trainingsdatensatzes und in Abhängigkeit der Variabilitätsklasse die Abweichung der bodennahen Einstrahlung von Satellitendaten oder von Strahlungsprognosen quantifiziert. Diese Art der Informationen bietet zukünftig die Möglichkeit zur Bewertung der Prognosegüte.
The clear-sky radiative effect of aerosol–radiation interactions is of relevance for our understanding of the climate system. The influence of aerosol on the surface energy budget is of high interest for the renewable energy sector. In this study, the radiative effect is investigated in particular with respect to seasonal and regional variations for the region of Germany and the year 2015 at the surface and top of atmosphere using two complementary approaches.
First, an ensemble of clear-sky models which explicitly consider aerosols is utilized to retrieve the aerosol optical depth and the surface direct radiative effect of aerosols by means of a clear-sky fitting technique. For this, short-wave broadband irradiance measurements in the absence of clouds are used as a basis. A clear-sky detection algorithm is used to identify cloud-free observations. Considered are measurements of the short-wave broadband global and diffuse horizontal irradiance with shaded and unshaded pyranometers at 25 stations across Germany within the observational network of the German Weather Service (DWD). The clear-sky models used are the Modified MAC model (MMAC), the Meteorological Radiation Model (MRM) v6.1, the Meteorological–Statistical solar radiation model (METSTAT), the European Solar Radiation Atlas (ESRA), Heliosat-1, the Center for Environment and Man solar radiation model (CEM), and the simplified Solis model. The definition of aerosol and atmospheric characteristics of the models are examined in detail for their suitability for this approach.
Second, the radiative effect is estimated using explicit radiative transfer simulations with inputs on the meteorological state of the atmosphere, trace gases and aerosol from the Copernicus Atmosphere Monitoring Service (CAMS) reanalysis. The aerosol optical properties (aerosol optical depth, Ångström exponent, single scattering albedo and asymmetry parameter) are first evaluated with AERONET direct sun and inversion products. The largest inconsistency is found for the aerosol absorption, which is overestimated by about 0.03 or about 30 % by the CAMS reanalysis. Compared to the DWD observational network, the simulated global, direct and diffuse irradiances show reasonable agreement within the measurement uncertainty. The radiative kernel method is used to estimate the resulting uncertainty and bias of the simulated direct radiative effect. The uncertainty is estimated to −1.5 ± 7.7 and 0.6 ± 3.5 W m−2 at the surface and top of atmosphere, respectively, while the annual-mean biases at the surface, top of atmosphere and total atmosphere are −10.6, −6.5 and 4.1 W m−2, respectively.
The retrieval of the aerosol radiative effect with the clear-sky models shows a high level of agreement with the radiative transfer simulations, with an RMSE of 5.8 W m−2 and a correlation of 0.75. The annual mean of the REari at the surface for the 25 DWD stations shows a value of −12.8 ± 5 W m−2 as the average over the clear-sky models, compared to −11 W m−2 from the radiative transfer simulations. Since all models assume a fixed aerosol characterization, the annual cycle of the aerosol radiation effect cannot be reproduced. Out of this set of clear-sky models, the largest level of agreement is shown by the ESRA and MRM v6.1 models.
This study investigates the effects of four multifunctional chain-extending cross-linkers (CECL) on the processability, mechanical performance, and structure of polybutylene adipate terephthalate (PBAT) and polylactic acid (PLA) blends produced using film blowing technology. The newly developed reference compound (M·VERA® B5029) and the CECL modified blends are characterized with respect to the initial properties and the corresponding properties after aging at 50 °C for 1 and 2 months. The tensile strength, seal strength, and melt volume rate (MVR) are markedly changed after thermal aging, whereas the storage modulus, elongation at the break, and tear resistance remain constant. The degradation of the polymer chains and crosslinking with increased and decreased MVR, respectively, is examined thoroughly with differential scanning calorimetry (DSC), with the results indicating that the CECL-modified blends do not generally endure thermo-oxidation over time. Further, DSC measurements of 25 µm and 100 µm films reveal that film blowing pronouncedly changes the structures of the compounds. These findings are also confirmed by dynamic mechanical analysis, with the conclusion that tris(2,4-di-tert-butylphenyl)phosphite barely affects the glass transition temperature, while with the other changes in CECL are seen. Cross-linking is found for aromatic polycarbodiimide and poly(4,4-dicyclohexylmethanecarbodiimide) CECL after melting of granules and films, although overall the most synergetic effect of the CECL is shown by 1,3-phenylenebisoxazoline.
Background & Objective: Due to the policy goals for sustainable energy production, renewable energy plants such as photovoltaics are increasingly in use. The energy production from solar radiation depends strongly on atmospheric conditions. As the weather mostly changes, electrical power generation fluctuates, making technical planning and control of power grids to a complex problem. Due to used materials (semiconductors e.g. silicon, gallium arsenide, cadmium telluride) the photovoltaic cells are spectrally selective. It means that only radiation of certain wavelengths converts into electrical energy. A material property called spectral response characterizes a certain degree of conversion of solar radiation into the electric current for each wavelength of solar light.
Messkampagnen im Projekt METPVNET zur Verbesserung der PV- Erzeugungsprognose auf Verteilnetzebene
(2018)
In contrast to the German power supply, the energy supply in many West African countries is very unstable. Frequent power outages are not uncommon. Especially for critical infrastructures, such as hospitals, a stable power supply is vital. To compensate for the power outages, diesel generators are often used. In the future, these systems will increasingly be supplemented by PV systems and storage, so that the generator will have to be used less or not at all when needed. For the design and operation of such systems, it is necessary to better understand the atmospheric variability of PV power generation. For example, there are large variations between rainy and dry seasons, between days with high and low dust levels - caused by sandstorms (harmattan) or urban air pollution.
In view of the rapid growth of solar power installations worldwide, accurate forecasts of photovoltaic (PV) power generation are becoming increasingly indispensable for the overall stability of the electricity grid. In the context of household energy storage systems, PV power forecasts contribute towards intelligent energy management and control of PV-battery systems, in particular so that self-sufficiency and battery lifetime are maximised. Typical battery control algorithms require day-ahead forecasts of PV power generation, and in most cases a combination of statistical methods and numerical weather prediction (NWP) models are employed. The latter are however often inaccurate, both due to deficiencies in model physics as well as an insufficient description of irradiance variability.
Turbulent compressible flows are traditionally simulated using explicit time integrators applied to discretized versions of the Navier-Stokes equations. However, the associated Courant-Friedrichs-Lewy condition severely restricts the maximum time-step size. Exploiting the Lagrangian nature of the Boltzmann equation’s material derivative, we now introduce a feasible three-dimensional semi-Lagrangian lattice Boltzmann method (SLLBM), which circumvents this restriction. While many lattice Boltzmann methods for compressible flows were restricted to two dimensions due to the enormous number of discrete velocities in three dimensions, the SLLBM uses only 45 discrete velocities. Based on compressible Taylor-Green vortex simulations we show that the new method accurately captures shocks or shocklets as well as turbulence in 3D without utilizing additional filtering or stabilizing techniques other than the filtering introduced by the interpolation, even when the time-step sizes are up to two orders of magnitude larger compared to simulations in the literature. Our new method therefore enables researchers to study compressible turbulent flows by a fully explicit scheme, whose range of admissible time-step sizes is dictated by physics rather than spatial discretization.
Solving transport network problems can be complicated by non-linear effects. In the particular case of gas transport networks, the most complex non-linear elements are compressors and their drives. They are described by a system of equations, composed of a piecewise linear ‘free’ model for the control logic and a non-linear ‘advanced’ model for calibrated characteristics of the compressor. For all element equations, certain stability criteria must be fulfilled, providing the absence of folds in associated system mapping. In this paper, we consider a transformation (warping) of a system from the space of calibration parameters to the space of transport variables, satisfying these criteria. The algorithm drastically improves stability of the network solver. Numerous tests on realistic networks show that nearly 100% convergence rate of the solver is achieved with this approach.
This book discusses the development of the Rosenbrock—Wanner methods from the origins of the idea to current research with the stable and efficient numerical solution and differential-algebraic systems of equations, still in focus. The reader gets a comprehensive insight into the classical methods as well as into the development and properties of novel W-methods, two-step and exponential Rosenbrock methods. In addition, descriptive applications from the fields of water and hydrogen network simulation and visual computing are presented. (Verlagsangaben)
The clear-sky radiative effect of aerosol-radiation interactions is of relevance for our understanding of the climate system. The influence of aerosol on the surface energy budget is of high interest for the renewable energy sector. In this study, the radiative effect is investigated in particular with respect to seasonal and regional variations for the region of Germany and the year 2015 at the surface and top of atmosphere using two complementary approaches.
First, an ensemble of clear-sky models which explicitly consider aerosols is utilized to retrieve the aerosol optical depth and the surface direct radiative effect of aerosols by means of a clear sky fitting technique. For this, short-wave broadband irradiance measurements in the absence of clouds are used as a basis. A clear sky detection algorithm is used to identify cloud free observations. Considered are measurements of the shortwave broadband global and diffuse horizontal irradiance with shaded and unshaded pyranometers at 25 stations across Germany within the observational network of the German Weather Service (DWD). Clear sky models used are MMAC, MRMv6.1, METSTAT, ESRA, Heliosat-1, CEM and the simplified Solis model. The definition of aerosol and atmospheric characteristics of the models are examined in detail for their suitability for this approach.
Second, the radiative effect is estimated using explicit radiative transfer simulations with inputs on the meteorological state of the atmosphere, trace-gases and aerosol from CAMS reanalysis. The aerosol optical properties (aerosol optical depth, Ångström exponent, single scattering albedo and assymetrie parameter) are first evaluated with AERONET direct sun and inversion products. The largest inconsistency is found for the aerosol absorption, which is overestimated by about 0.03 or about 30 % by the CAMS reanalysis. Compared to the DWD observational network, the simulated global, direct and diffuse irradiances show reasonable agreement within the measurement uncertainty. The radiative kernel method is used to estimate the resulting uncertainty and bias of the simulated direct radiative effect. The uncertainty is estimated to −1.5 ± 7.7 and 0.6 ± 3.5 W m−2 at the surface and top of atmosphere, respectively, while the annual-mean biases at the surface, top of atmosphere and total atmosphere are −10.6, −6.5 and 4.1 W m−2, respectively.
The retrieval of the aerosol radiative effect with the clear sky models shows a high level of agreement with the radiative transfer simulations, with an RMSE of 5.8 W m−2 and a correlation of 0.75. The annual mean of the REari at the surface for the 25 DWD stations shows a value of −12.8 ± 5 W m−2 as average over the clear sky models, compared to −11 W m−2 from the radiative transfer simulations. Since all models assume a fixed aerosol characterisation, the annual cycle of the aerosol radiation effect cannot be reproduced. Out of this set of clear sky models, the largest level of agreement is shown by the ESRA and MRMv6.1 models.
An der H-BRS, einer Hochschule für Angewandte Wissenschaften mit ca. 9.000 Studierenden, wurde die OER-Kultur bewusst als Teil der Strategie zur Digitalisierung der Lehre in drei Schritten etabliert: (1) Gemeinsame Strategiebildung als Teil eines partizipativ erarbeiteten Hochschulentwicklungsplans: Verankerung von OER in der Digitalisierungsstrategie. (2) Basierend auf der Vernetzung der Expertinnen und Experten erfolgreiche Einwerbung von OER-Projekten, die exemplarisch vorgestellt werden. (3) Dauerhafte strategische Verankerung, basierend auf kontinuierlicher interner und externer Netzwerkarbeit, Etablierung von digitalen Austauschplattformen für die Lehrenden, Transfer des OER-Gedankens (Kooperation, Austausch, Mehrfachnutzen) auf die Hochschuldidaktik sowie regelmäßige Ausschreibungen von Fördermaßnahmen.
The lattice Boltzmann method (LBM) is an efficient simulation technique for computational fluid mechanics and beyond. It is based on a simple stream-and-collide algorithm on Cartesian grids, which is easily compatible with modern machine learning architectures. While it is becoming increasingly clear that deep learning can provide a decisive stimulus for classical simulation techniques, recent studies have not addressed possible connections between machine learning and LBM. Here, we introduce Lettuce, a PyTorch-based LBM code with a threefold aim. Lettuce enables GPU accelerated calculations with minimal source code, facilitates rapid prototyping of LBM models, and enables integrating LBM simulations with PyTorch's deep learning and automatic differentiation facility. As a proof of concept for combining machine learning with the LBM, a neural collision model is developed, trained on a doubly periodic shear layer and then transferred to a different flow, a decaying turbulence. We also exemplify the added benefit of PyTorch's automatic differentiation framework in flow control and optimization. To this end, the spectrum of a forced isotropic turbulence is maintained without further constraining the velocity field.
We consider multi-solution optimization and generative models for the generation of diverse artifacts and the discovery of novel solutions. In cases where the domain's factors of variation are unknown or too complex to encode manually, generative models can provide a learned latent space to approximate these factors. When used as a search space, however, the range and diversity of possible outputs are limited to the expressivity and generative capabilities of the learned model. We compare the output diversity of a quality diversity evolutionary search performed in two different search spaces: 1) a predefined parameterized space and 2) the latent space of a variational autoencoder model. We find that the search on an explicit parametric encoding creates more diverse artifact sets than searching the latent space. A learned model is better at interpolating between known data points than at extrapolating or expanding towards unseen examples. We recommend using a generative model's latent space primarily to measure similarity between artifacts rather than for search and generation. Whenever a parametric encoding is obtainable, it should be preferred over a learned representation as it produces a higher diversity of solutions.
The promotion of sustainable packaging is part of the European Green Deal and plays a key role in the EU’s social and political strategy. One option is the use of renewable resources and biomass waste as raw materials for polymer production. Lignocellulose biomass from annual and perennial industrial crops and agricultural residues are a major source of polysaccharides, proteins, and lignin and can also be used to obtain plant-based extracts and essential oils. Therefore, these biomasses are considered as potential substitute for fossil-based resources. Here, the status quo of bio-based polymers is discussed and evaluated in terms of properties related to packaging applications such as gas and water vapor permeability as well as mechanical properties. So far, their practical use is still restricted due to lower performance in fundamental packaging functions that directly influence food quality and safety, the length of shelf life, and thus the amount of food waste. Besides bio-based polymers, this review focuses on plant extracts as active packaging agents. Incorporating extracts of herbs, flowers, trees, and their fruits is inevitable to achieve desired material properties that are capable to prolong the food shelf life. Finally, the adoption potential of packaging based on polymers from renewable resources is discussed from a bioeconomy perspective.
Design of a Medium Voltage Generator with DC-Cascade for High Power Wind Energy Conversion Systems
(2021)
This paper shows a new concept to generate medium voltage (MV) in wind power application to avoid an additional transformer. Therefore, the generator must be redesigned with additional constraints and a new topology for the power rectifier system by using multiple low voltage (LV) power rectifiers connected in series and parallel to increase the DC output voltage. The combination of parallel and series connection of rectifiers is further introduced as DC-cascade. With the resulting DC-cascade, medium output voltage is achieved with low voltage rectifiers and without a bulky transformer. This approach to form a DC-cascade reduces the effort required to achieve medium DC voltage with a simple rectifier system. In this context, a suitable DC-cascade control was presented and verified with a laboratory test setup. A gearless synchronous generator, which is highly segmented so that each segment can be connected to its own power rectifier, is investigated. Due to the mixed AC and DC voltage given by the DC-cascade structure, it becomes more demanding to the design of the generator insulation, which influences the copper fill factor and the design of the cooling system. A design strategy for the overall generator design is carried out considering the new boundary conditions.
Energy Profiles of the Ring Puckering of Cyclopentane, Methylcyclopentane and Ethylcyclopentane
(2019)
Photovoltaic (PV) power data are a valuable but as yet under-utilised resource that could be used to characterise global irradiance with unprecedented spatio-temporal resolution. The resulting knowledge of atmospheric conditions can then be fed back into weather models and will ultimately serve to improve forecasts of PV power itself. This provides a data-driven alternative to statistical methods that use post-processing to overcome inconsistencies between ground-based irradiance measurements and the corresponding predictions of regional weather models (see for instance Frank et al., 2018). This work reports first results from an algorithm developed to infer global horizontal irradiance as well as atmospheric optical properties such as aerosol or cloud optical depth from PV power measurements.
The genetic basis of brain tumor development is poorly understood. Here, leukocyte DNA of 21 patients from 15 families with ≥ 2 glioma cases each was analyzed by whole-genome or targeted sequencing. As a result, we identified two families with rare germline variants, p.(A592T) or p.(A817V), in the E-cadherin gene CDH1 that co-segregate with the tumor phenotype, consisting primarily of oligodendrogliomas, WHO grade II/III, IDH-mutant, 1p/19q-codeleted (ODs). Rare CDH1 variants, previously shown to predispose to gastric and breast cancer, were significantly overrepresented in these glioma families (13.3%) versus controls (1.7%). In 68 individuals from 28 gastric cancer families with pathogenic CDH1 germline variants, brain tumors, including a pituitary adenoma, were observed in three cases (4.4%), a significantly higher prevalence than in the general population (0.2%). Furthermore, rare CDH1 variants were identified in tumor DNA of 6/99 (6%) ODs. CDH1 expression was detected in undifferentiated and differentiating oligodendroglial cells isolated from rat brain. Functional studies using CRISPR/Cas9-mediated knock-in or stably transfected cell models demonstrated that the identified CDH1 germline variants affect cell membrane expression, cell migration and aggregation. E-cadherin ectodomain containing variant p.(A592T) had an increased intramolecular flexibility in a molecular dynamics simulation model. E-cadherin harboring intracellular variant p.(A817V) showed reduced β-catenin binding resulting in increased cytosolic and nuclear β-catenin levels reverted by treatment with the MAPK interacting serine/threonine kinase 1 inhibitor CGP 57380. Our data provide evidence for a role of deactivating CDH1 variants in the risk and tumorigenesis of neuroepithelial and epithelial brain tumors, particularly ODs, possibly via WNT/β-catenin signaling.
The analysis of used engine oils from industrial engines enables the study of engine wear and oil degradation in order to evaluate the necessity of oil changes. As the matrix composition of an engine oil strongly depends on its intended application, meaningful diagnostic oil analyses bear considerable challenges. Owing to the broad spectrum of available oil matrices, we have evaluated the applicability of using an internal standard and/or preceding sample digestion for elemental analysis of used engine oils via inductively coupled plasma optical emission spectroscopy (ICP OES). Elements originating from both wear particles and additives as well as particle size influence could be clearly recognized by their distinct digestion behaviour. While a precise determination of most wear elements can be achieved in oily matrix, the measurement of additives is performed preferably after sample digestion. Considering a dataset of physicochemical parameters and elemental composition for several hundred used engine oils, we have further investigated the feasibility of predicting the identity and overall condition of an unknown combustion engine using the machine learning system XGBoost. A maximum accuracy of 89.6% in predicting the engine type was achieved, a mean error of less than 10% of the observed timeframe in predicting the oil running time and even less than 4% for the total engine running time, based purely on common oil check data. Furthermore, obstacles and possibilities to improve the performance of the machine learning models were analysed and the factors that enabled the prediction were explored with SHapley Additive exPlanation (SHAP). Our results demonstrate that both the identification of an unknown engine as well as a lifetime assessment can be performed for a first estimation of the actual sample without requiring meticulous documentation.
Off-lattice Boltzmann methods increase the flexibility and applicability of lattice Boltzmann methods by decoupling the discretizations of time, space, and particle velocities. However, the velocity sets that are mostly used in off-lattice Boltzmann simulations were originally tailored to on-lattice Boltzmann methods. In this contribution, we show how the accuracy and efficiency of weakly and fully compressible semi-Lagrangian off-lattice Boltzmann simulations is increased by velocity sets derived from cubature rules, i.e. multivariate quadratures, which have not been produced by the Gauß-product rule. In particular, simulations of 2D shock-vortex interactions indicate that the cubature-derived degree-nine D2Q19 velocity set is capable to replace the Gauß-product rule-derived D2Q25. Likewise, the degree-five velocity sets D3Q13 and D3Q21, as well as a degree-seven D3V27 velocity set were successfully tested for 3D Taylor–Green vortex flows to challenge and surpass the quality of the customary D3Q27 velocity set. In compressible 3D Taylor–Green vortex flows with Mach numbers on-lattice simulations with velocity sets D3Q103 and D3V107 showed only limited stability, while the off-lattice degree-nine D3Q45 velocity set accurately reproduced the kinetic energy provided by literature.
Die Kunst, Kunst zu zeigen
(2021)
TREE Jahresbericht 2019/2020
(2021)
Der Jahresbericht soll in seiner Breite als auch in seiner Tiefe die Stärken unserer gemeinschaftlichen Anstrengungen im Forschungsfeld der nachhaltigen Technologien aufzeigen: interdisziplinär, forschungsstark, nachwuchsfördernd und gesellschaftszugewandt.
Im vergangenen Jahr war die Pandemie auch für das Insitut TREE eine Herausforderung. Wie die Mitglieder mit der Umstellung auf eine hauptsächlich online stattfindende Kommunikation umgegangen sind und wie das Hochschulleben sich dadurch verändert hat, wurde im Jahresbericht unter "See you online" festgehalten. Auch der Wechsel im Direktorium des Instituts ist Thema des diesjährigen Jahresberichts. Unter den Hauptthemen "Wissenschaftstransfer", "TREE und Wirtschaft" und "Transfer Öffentlichkeit" können sie die wichtigsten Ereignisse für das Institut in den Jahren 2019 und 2020 nachlesen.
Am Beispiel einer jahrelang in Präsenz gelehrten Veranstaltung mit Vorlesungen, Übungen und Laborpraktika wird gezeigt, wie die Vermittlung prüfungsrelevanter Kompetenzen auch „online“ gelang. Das passende „Setting“ des Lehr- und Lernprozesses unter Beachtung von Handlungsempfehlungen ist auch für die Zukunft relevant.
In this contribution, we perform computer simulations to expedite the development of hydrogen storages based on metal hydride. These simulations enable in-depth analysis of the processes within the systems which otherwise could not be achieved. That is, because the determination of crucial process properties require measurement instruments in the setup which are currently not available. Therefore, we investigate the reliability of reaction values that are determined by a design of experiments.
Specifically, we first explain our model setup in detail. We define the mathematical terms to obtain insights into the thermal processes and reaction kinetics. We then compare the simulated results to measurements of a 5-gram sample consisting of iron-titanium-manganese (FeTiMn) to obtain the values with the highest agreement with the experimental data. In addition, we improve the model by replacing the commonly used Van’t-Hoff equation by a mathematical expression of the pressure-composition-isotherms (PCI) to calculate the equilibrium pressure.
Finally, the parameters’ accuracy is checked in yet another with an existing metal hydride system. The simulated results demonstrate high concordance with experimental data, which advocate the usage of approximated kinetic reaction properties by a design of experiments for further design studies. Furthermore, we are able to determine process parameters like the entropy and enthalpy.
Ghana suffers from frequent power outages, which can be compensated by off-grid energy solutions. Photovoltaic-hybrid systems become more and more important for rural electrification due to their potential to offer a clean and cost-effective energy supply. However, uncertainties related to the prediction of electrical loads and solar irradiance result in inefficient system control and can lead to an unstable electricity supply, which is vital for the high reliability required for applications within the health sector. Model predictive control (MPC) algorithms present a viable option to tackle those uncertainties compared to rule-based methods, but strongly rely on the quality of the forecasts. This study tests and evaluates (a) a seasonal autoregressive integrated moving average (SARIMA) algorithm, (b) an incremental linear regression (ILR) algorithm, (c) a long short-term memory (LSTM) model, and (d) a customized statistical approach for electrical load forecasting on real load data of a Ghanaian health facility, considering initially limited knowledge of load and pattern changes through the implementation of incremental learning. The correlation of the electrical load with exogenous variables was determined to map out possible enhancements within the algorithms. Results show that all algorithms show high accuracies with a median normalized root mean square error (nRMSE) <0.1 and differing robustness towards load-shifting events, gradients, and noise. While the SARIMA algorithm and the linear regression model show extreme error outliers of nRMSE >1, methods via the LSTM model and the customized statistical approaches perform better with a median nRMSE of 0.061 and stable error distribution with a maximum nRMSE of <0.255. The conclusion of this study is a favoring towards the LSTM model and the statistical approach, with regard to MPC applications within photovoltaic-hybrid system solutions in the Ghanaian health sector.
The actomyosin system generates mechanical work with the execution of the power stroke, an ATP-driven, two-step rotational swing of the myosin-neck that occurs post ATP hydrolysis during the transition from weakly to strongly actin-bound myosin states concomitant with Pi release and prior to ADP dissociation. The activating role of actin on product release and force generation is well documented; however, the communication paths associated with weak-to-strong transitions are poorly characterized. With the aid of mutant analyses based on kinetic investigations and simulations, we identified the W-helix as an important hub coupling the structural changes of switch elements during ATP hydrolysis to temporally controlled interactions with actin that are passed to the central transducer and converter. Disturbing the W-helix/transducer pathway increased actin-activated ATP turnover and reduced motor performance as a consequence of prolonged duration of the strongly actin-attached states. Actin-triggered Pi release was accelerated, while ADP release considerably decelerated, both limiting maximum ATPase, thus transforming myosin-2 into a high-duty-ratio motor. This kinetic signature of the mutant allowed us to define the fractional occupancies of intermediate states during the ATPase cycle providing evidence that myosin populates a cleft-closure state of strong actin interaction during the weak-to-strong transition with bound hydrolysis products before accomplishing the power stroke.
Turbulent compressible flows are traditionally simulated using explicit Eulerian time integration applied to the Navier-Stokes equations. However, the associated Courant-Friedrichs-Lewy condition severely restricts the maximum time step size. Exploiting the Lagrangian nature of the Boltzmann equation's material derivative, we now introduce a feasible three-dimensional semi-Lagrangian lattice Boltzmann method (SLLBM), which elegantly circumvents this restriction. Previous lattice Boltzmann methods for compressible flows were mostly restricted to two dimensions due to the enormous number of discrete velocities needed in three dimensions. In contrast, this Rapid Communication demonstrates how cubature rules enhance the SLLBM to yield a three-dimensional velocity set with only 45 discrete velocities. Based on simulations of a compressible Taylor-Green vortex we show that the new method accurately captures shocks or shocklets as well as turbulence in 3D without utilizing additional filtering or stabilizing techniques, even when the time step sizes are up to two orders of magnitude larger compared to simulations in the literature. Our new method therefore enables researchers for the first time to study compressible turbulent flows by a fully explicit scheme, whose range of admissible time step sizes is only dictated by physics, while being decoupled from the spatial discretization.
Medien spielen eine Schlüsselrolle für die öffentliche Meinung und Akzeptanz neuer Technologien. Mit einer qualitativen Inhaltsanalyse journalistischer Artikel zum Elektrofahrrad wurden Akteure und ihre Einstellungen und Handlungen in Bezug auf das Elektrofahrrad untersucht. In die Analyse flossen 444 Artikel ausgewählter deutscher Qualitätsmedien aus dem Jahr 2018 ein. Die Untersuchung zeigt den gesellschaftlich relevanten Diskurs über Elektrofahrräder auf und bietet Anknüpfungspunkte für die Förderung von Individualmobilität und der Entwicklung zukunftsfähiger Mobilitätskonzepte.
Bionik
(2020)
Wie machen die das... kann angesichts der erstaunlichen Fähigkeiten mancher Lebewesen gefragt werden. Die Bionik fragt noch weiter …und wie kann man das nachmachen? Hier liegt ein Schwerpunkt dieses Lehrbuches, das die Bionik nicht nur an zahlreichen Beispielen erklärt, sondern auch eine Vorgehensweise für die Identifizierung biologischer Lösungen und deren Übertragung auf technische Anwendungen vermittelt. Basisinformationen der Biologie und Grundlagen der Konstruktionstechnik gewährleisten einen leichten Zugang zum Stoff. Mit dem 3D-Druck als Schlüsseltechnologie und der Thematisierung der Nachhaltigkeit geht das Buch zudem auf aktuelle Entwicklungen ein. Dieser ganzheitliche Blick auf die Bionik soll den Leser zur Durchführung bionischer Projekte befähigen und motivieren. (Verlagsangaben)