Refine
H-BRS Bibliography
- yes (241) (remove)
Departments, institutes and facilities
- Institut für funktionale Gen-Analytik (IFGA) (241) (remove)
Document Type
- Article (183)
- Conference Object (32)
- Part of a Book (23)
- Contribution to a Periodical (1)
- Preprint (1)
- Working Paper (1)
Year of publication
Keywords
- cytokine-induced killer cells (9)
- immunotherapy (7)
- Organic aciduria (5)
- CD21 (4)
- ENaC (4)
- Inborn error of metabolism (4)
- Arthritis (3)
- DNA damage (3)
- DNA typing (3)
- K/BxN (3)
- Ketolysis (3)
- Ketone body (3)
- Metabolic acidosis (3)
- apoptosis (3)
- cytokine-induced killer (CIK) cells (3)
- extremophiles (3)
- shedding (3)
- 3-hydroxyisobutyrate dehydrogenase (2)
- 3-hydroxyisobutyric aciduria (2)
- Aminoacylase (2)
- B cell activation (2)
- CIK cells (2)
- Canavan disease (2)
- Complement receptor (2)
- Complement receptor 2/CD21 (2)
- Content Module (2)
- DNA (2)
- Enzyme activity (2)
- Fatty acid metabolism (2)
- Fuzzy logic (2)
- GLYCTK (2)
- Glycine conjugation (2)
- HIBADH (2)
- HIBADH deficiency (2)
- Isovaleric acidemia (2)
- Ketoacidosis (2)
- Ketogenesis (2)
- Ketone body utilization (2)
- Mars (2)
- Mass spectrometry (2)
- Membrane Transport (2)
- Metabolic decompensation (2)
- Original Story (2)
- Rheumatoid arthritis (2)
- SLC (2)
- Shedding (2)
- Short tandem repeat (STR) (2)
- Valproic acid (2)
- Whole genome amplification (2)
- autophagy (2)
- cell death (2)
- d-Glycerate kinase deficiency (2)
- d-Glyceric aciduria (2)
- edutainment (2)
- evolution (2)
- extraterrestrial analogue (2)
- extremophile (2)
- force generation (2)
- fungi (2)
- hypermedia (2)
- ketogenesis (2)
- ketolysis (2)
- life detection (2)
- lymphoma (2)
- melanin (2)
- myosin (2)
- organic aciduria (2)
- 16S rRNA gene sequencing (1)
- 2B4 (1)
- 3-hydroxy-n-butyric acid (1)
- 3-hydroxyisobutyrate dehydrogenase deficiency (1)
- 3-hydroxyisobutyric acid dehydrogenase deficiency (1)
- 3D shape (1)
- 5-Oxoprolinase (1)
- 5-oxoprolinuria (1)
- ACAT1 (1)
- ACacylcarnitines (1)
- ADP release (1)
- AMAtypical myopathy (1)
- AMT (1)
- APC superfamily (1)
- AR (1)
- ASIC (1)
- ASPA (1)
- ATB0,+ (1)
- ATF4 (1)
- ATF6 (1)
- ATPase cycle (1)
- Acute lymphoblastic leukemia (1)
- Acylpeptide hydrolase (1)
- Affinity proteomics (1)
- Algorithms (1)
- Alkane (1)
- Aminoacylase 1 (1)
- Amylose stationary phases (1)
- Ankle Joint (1)
- Ankle thickness (1)
- Antarctic Polar Plateau (1)
- Antarctic ice sheet (1)
- Antibodies* (1)
- Antibody Induced Arthritis (1)
- Antibody analysis (1)
- Antigen analysis (1)
- Antiphospholipid syndrome (APS) (1)
- Apheresis therapy (1)
- Articular Cartilage (1)
- Aspartoacylase (1)
- Assay development (1)
- Augmented reality (1)
- Autism (1)
- Autoantibody (1)
- Autophagy induction (1)
- B cells (1)
- B lymphocyte (1)
- B-cell lymphoma (1)
- BLAST (1)
- Bacillus (1)
- Background music (1)
- Bacteria, Anaerobic (1)
- Bactericidal effect (1)
- Basis set (1)
- BcL-2 family (1)
- Bcl-2 (1)
- Beta-ketothiolase (1)
- Beta-ketothiolase deficiency (1)
- Bicycle Simulator (1)
- Biomarkers stability (1)
- Biophysics (1)
- Biosignatures (1)
- CD146 (1)
- CD30+ cells (1)
- CD40 (1)
- CD40, CTLA-4 (1)
- CDH1 (1)
- CFTR inhibitors (1)
- CFTR mutations (1)
- CIBERSORT (1)
- CIK-Zellen (1)
- CR2 (1)
- CREBBP (1)
- Cancer (1)
- Carbapenem (1)
- Carboxy-terminal fragments (1)
- Carcinogenic (1)
- Cartilage Destruction (1)
- Cell activation (1)
- Cellulose stationary phases (1)
- Cervical cancer screening (1)
- Cervicovaginal microbiome (1)
- Chaetocin (1)
- Chalcogenide glass sensor (1)
- Chiral stationary phases (1)
- Chloroquine (1)
- Chromatogramm (1)
- Chronic lymphocytic leukemia (1)
- Cislunar (1)
- Cognition (1)
- Collision induced dissociation (1)
- Color/Spot-Test (1)
- Colposcopy (1)
- Complement (1)
- Complement receptor 2 (1)
- Complement receptor 2 /CD21 (1)
- Computer Graphics (1)
- Confocal microscopy (1)
- Container Structure (1)
- Cross-sensitivity (1)
- Cytokine (1)
- Cytokine-induced killer (CIK) cells (1)
- DBSdried blot spots (1)
- DIDMOAD (1)
- DNA double- strand breaks (1)
- DNA extraction protocols (1)
- DNA methylation (1)
- DNA profile (1)
- Daptomycin (1)
- Database Management Systems (1)
- Degraded DNA (1)
- Dehydrogenase (1)
- Diaminphenylderivat (1)
- Digital Storytelling (1)
- Diselenide bridge (1)
- Docking (1)
- Dried serum spots (1)
- Drift tube (1)
- Drug resistance (1)
- Dystonia (1)
- E-cadherin (1)
- EEG (1)
- ER stress (1)
- ERO1α (1)
- ESKAPEE pathogens (1)
- Ectodomain shedding (1)
- Electronic tongue (1)
- Elephantiasis (1)
- Enantioselective gas chromatography (1)
- Endoplasmatic reticulum (1)
- Endosomes (1)
- Endothelial cells (1)
- Enzyme activity assays (1)
- Epilepsy (1)
- Epitope mapping: Epitope extraction (1)
- Eriodictyol (1)
- Ewing´s Sarcoma Family of Tumors (1)
- ExoMars (1)
- FGR (1)
- FOXP3 (1)
- Fabry disease (1)
- Familial glioma (1)
- Fe-ion radiation (1)
- Fibroblast-like synoviocytes (FLS) (1)
- Forensic genetics (1)
- Forensic genomics (1)
- Fructose (1)
- GC–MSgas chromatography–mass spectrometry (1)
- Galactic Cosmic Rays (GCRs) (1)
- Gas chromatography (1)
- Gelatin Zymography (1)
- Genomics/methods (1)
- Gesamt-Exom-Sequenzierung (1)
- Glutathione (1)
- Glutathione synthetase (1)
- Glycerate (1)
- Glyceric aciduria (1)
- Glycine N-Acyltransferase (GLYAT) (1)
- Glycine N-acyltransferase (1)
- Glycogen storage disease type (1)
- Glycopeptides (1)
- HCI (1)
- HDAC inhibitor (1)
- HIF1α (1)
- HMGCL (1)
- HPLC Optimierung (1)
- HPV diagnostic (1)
- HSD10 (1)
- HSP90 (1)
- Head-Mounted Displays (1)
- Health care policy (1)
- High hyperdiploidy (1)
- High performance liquid chromatography (1)
- Humans (1)
- Hydroxychloroquine (1)
- Hyperammonemia (1)
- Hypoglycemia (1)
- IR microspectroscopy (1)
- IRE1 (1)
- Ikaros (1)
- Illegal Wildlife Trade (1)
- Immersive Virtual Environments (1)
- Immersive Visualization Environment (1)
- Immune escape (1)
- Immunoadsorption (1)
- Immunology* (1)
- In silico epitope prediction (1)
- In silico modelling (1)
- Inborn errors of metabolism (1)
- Inherited metabolic disorders (1)
- Inhibitor (1)
- Ion mobility (1)
- Ion mobility spectrometer (1)
- Ionizing radiation (1)
- Isoleucine (1)
- Isoleucine degradation (1)
- Joint Destruction (1)
- Juvenile arthritis (JA) (1)
- K/BxN mouse model (1)
- K/B×N model (1)
- Ketoasidoz (1)
- Ketogenic diet (1)
- Ketone body synthesis (1)
- Kozak-sequence (1)
- Kriminaltechnik (1)
- LET (1)
- LFA-1 (1)
- Leg (1)
- LeuT (1)
- Leucine (1)
- Leucine degradation (1)
- Ligand -Receptor Interactions* (1)
- Linezolid (1)
- Locomotion (1)
- Lymphedema (1)
- Lysosome (1)
- Lysosomes (1)
- MADDMultiple acyl-CoA dehydrogenase deficiency (1)
- MALDI QIT TOF MS (1)
- MCT (1)
- MICA/B (1)
- MMP-9 (1)
- MOCS1 (1)
- MP2.5 (1)
- MPV17 monoclonal antibody (1)
- MRPP (1)
- MS/MS peptide sequencing (1)
- Macrophage (1)
- Macrophage migration inhibitory factor (1)
- Macrophages (1)
- Magnetic resonance imaging (MRI) (1)
- Mars environment (1)
- Mars exploration (1)
- Mast cells (1)
- Matrix metalloproteases (1)
- Media in education (1)
- Memory (1)
- Metabolicdecompensation (1)
- Methyltransferase (1)
- Micromanipulation (1)
- Mitochondria (1)
- Mitochondrial DNA depletion syndrome (1)
- Mitochondrial apoptogens (1)
- Mitochondrial outer membrane permeabilization (MOMP) (1)
- Mitochondrial tRNA (1)
- Moco deficiency (1)
- Molecular dynamics (1)
- Molecular rotation (1)
- Molybdenum cofactor (1)
- Monocarboxylate transporter 1 (1)
- Motion tracking (1)
- Movement disorder (1)
- Multi-component heavy metal solution (1)
- N-acetylaspartic acid (1)
- N-acylated amino acids (1)
- N-isovalerylglycine (1)
- NGS (1)
- NKG2D (1)
- NSS family (1)
- Narration Module (1)
- Native mass spectrometry (1)
- Neugeborenenscreening (1)
- Neurometabolic disease (1)
- Neuropilin (1)
- Next Generation Sequencing (NGS) (1)
- Next generation sequencing (1)
- Nitrogruppe (1)
- Nitrosamine (1)
- Non-covalent interaction MS* (1)
- Nonketotic hyperglycinemia (1)
- OA, organic acids (1)
- OXCT1 (1)
- Occupational safety (1)
- Off-target effects (1)
- Oligodendroglioma (1)
- Orai1 (1)
- Organic acids (1)
- Organic compounds and Functional groups (1)
- Organische Säuren (1)
- Orion (1)
- PCR inhibitors (1)
- PD-1/CTLA-4 (1)
- PDI (1)
- PERK (1)
- PLASM (1)
- Pain Reduction (1)
- Partikeltechnologie (1)
- Patient serum (1)
- Peroxisomes (1)
- Pervanadate (1)
- Pharmacogenetics (1)
- Phase II reaction (1)
- Physical exercising game platform (1)
- Polymorphism (1)
- Pre-punched filter paper discs (1)
- Pregnancy (1)
- Probabilistic methods (1)
- Prognosis (1)
- Programmed cell death (1)
- Proteasome (1)
- Proteasome maturation (1)
- Protein complex analysis (1)
- Protein-protein interaction (1)
- Proteome analysis (1)
- Pyroglutamic aciduria (1)
- Quantum mechanical methods (1)
- Quasi equilibrium conditions (1)
- R751L (1)
- RAS (1)
- Raman and FTIR spectroscopies (1)
- Redox potential (1)
- Relapse (1)
- Relative Energies (1)
- Restorative Virtual Environments (1)
- S-sulfocysteine (1)
- SAHA (1)
- SARS-COV-2 virus (1)
- SARS-CoV-2 (1)
- SCNN1D (1)
- SERS (1)
- SGN-35 (1)
- SLC6 (1)
- SLC6A14 (1)
- SNPSTR (1)
- SOS-LC (1)
- STARLIFE project (1)
- Scalable Vector Graphic (1)
- Schmauchspur (1)
- Schusswaffe (1)
- Selektives Screening (1)
- Selenocysteine (1)
- Serine (1)
- Sexual assault (1)
- Silmitasertib (1)
- Single sperm cells (1)
- Skin (1)
- Soluble CD21 (1)
- Soluble CD23 (1)
- Space radiation (1)
- Splicing (1)
- Star Trek (1)
- Store-operated calcium entry (1)
- Story Element (1)
- Stress Management (1)
- Submerge and dry protocol (1)
- Sulfite oxidase (1)
- Survey (1)
- Synovial fluid (1)
- Systemic lupus erythomatosus (SLE) (1)
- TP53 (1)
- Tandem-Massenspektrometrie (1)
- Targeted mass spectrometry (1)
- Telemedicine (1)
- Telogen hair (1)
- Tetramerisation (1)
- Therapeutic antibodies* (1)
- Thiol antioxidants (1)
- Time–kill methodology (1)
- Transgenic mice (1)
- UI design (1)
- UPR signaling (1)
- UV-vis spectroscopy (1)
- Urea cycle defect (1)
- Urinary organic acids (1)
- Urine organic acid analysis (1)
- Urothione (1)
- User-Centered Approach (1)
- User-Computer Interface (1)
- VR (1)
- Vascular permeability (1)
- Virtual Environment (1)
- Virtual Memory Palace (1)
- Virtual Reality (1)
- Virtual reality (1)
- Vitamin A acetate isomers (1)
- Western blot (1)
- Whole-genome sequencing (1)
- Wild Type Mouse (1)
- Wildlife Forensics (1)
- Wnt/β-catenin (1)
- Wolframin (1)
- X-STR (1)
- XBP1 (1)
- Y-STR (1)
- Yeast (1)
- Zytokin-induzierte Killerzellen (1)
- accelerated iron ions (1)
- acetoacetic acid (1)
- acetone (1)
- actin (1)
- acute (1)
- adaptive filters (1)
- adoptive cell transfer (1)
- affective computing (1)
- albuminuria (1)
- alkaline phosphatase (1)
- allopurinol (1)
- allosteric communication (1)
- altered mitochondrial homeostasis (1)
- amino acid transporter (1)
- amplicon sequencing (1)
- anaplastic lymphoma kinase (1)
- anorganische Schmauchspur (1)
- antibody–drug conjugate (1)
- arthritis (1)
- astrobiology (1)
- autoimmune disease (1)
- automated electrophysiology (1)
- automation of sample processing (1)
- autophagy signaling pathways (1)
- bacteria (1)
- bdelloid rotifer (1)
- biochemical fingerprinting (1)
- biochemistry (1)
- biofilm removal (1)
- biofilm-related infections (1)
- bioinformatics (1)
- biomarker (1)
- black fungi (1)
- blebbistatin (1)
- brain computer interfaces (1)
- brain tumor (1)
- branched-chain amino acids (1)
- breast cancer (1)
- built environment (1)
- cPMP (1)
- cancer (1)
- cancer treatment (1)
- cannabidiol, immunotherapy (1)
- caspase (1)
- caspases (1)
- cell division (1)
- chaetocin (1)
- chemical pathology (1)
- chemical sensors (1)
- childhood (1)
- childhood cancer syndrome (1)
- ciclopirox olamine (1)
- clear cell renal cell carcinoma (1)
- clinical study (1)
- clinical trials (1)
- colorimetry (1)
- common variable immunodeficiency (1)
- compensation (1)
- complete basis set limit (1)
- computer vision (1)
- conformations (1)
- constitutional mismatch repair syndrome (1)
- cosmic rays (1)
- cyanide (1)
- cysticfibrosis (1)
- cytoskeleton (1)
- data base search (1)
- degraded DNA (1)
- delta-subunit (1)
- desert cyanobacteria (1)
- diagnosis and management (1)
- differentiation (1)
- digital storytelling (1)
- disabled people (1)
- distributed authoring (1)
- drugs (1)
- duty ratio (1)
- electrochemical sensor (1)
- electroretinography (1)
- emotion computing (1)
- endocytosis (1)
- endoplasmic reticulum (ER) stress (1)
- endoplasmic reticulum stress (1)
- enzyme activity (1)
- epithelial sodium channel (1)
- epithelial transport (1)
- epitope mapping (1)
- erbliche Krebssyndrome (1)
- ethacrynic acid (1)
- exon fusion (1)
- extra column band broadening (1)
- extraction-linked bias (1)
- fatty acid metabolism (1)
- fish gill (1)
- flow cytometry (1)
- forensic (1)
- forensic genetics (1)
- fuel (1)
- fungal and bacterial amplicon sequencing (1)
- fuzzy logic (1)
- gene expression (1)
- genes (1)
- genetic testing (1)
- genetics (1)
- genetische Testung (1)
- genomic data (1)
- glycerol (1)
- growth hormone (1)
- guidelines (1)
- habitability (1)
- healthcare-associated infections (HAI) (1)
- heat shock proteins (1)
- heat shock response (1)
- heavy ion particle (HZE) radations (1)
- heavy metal (1)
- hepatocellular carcinoma (1)
- heterozygous ALPL mutation (1)
- high-performance liquid chromatography (1)
- high-throughput DNA sequencing (1)
- high-throughput sequencing (1)
- histamine receptor (1)
- histamine receptor antagonist (1)
- histidine decarboxylase (1)
- histone deacetylase inhibitors (1)
- hospital environment (1)
- hospital-acquired infections (1)
- human microbiome (1)
- hydrocarbon (1)
- hypermedia applications (1)
- hypertension (1)
- hypogammaglobulinemia (1)
- hypophosphatasia (1)
- immune checkpoint inhibition programmed cell death-1 (1)
- immunhistochemistry (1)
- immunology (1)
- infection prevention (1)
- inherited metabolic disease (1)
- inorganic pyrophosphate (1)
- interactive computer graphics (1)
- interferon γ (1)
- intrinsic pathway (1)
- ion-selective electrodes (1)
- isoleucine (1)
- isoleucine metabolism (1)
- ketogenesis defects (1)
- ketogenez defektleri (1)
- ketoliz defektleri (1)
- ketolysis defects (1)
- keton bodies (1)
- ketone body synthesis (1)
- klarzelliges Nierenzellkarzinom (1)
- leucine (1)
- leucine degradation (1)
- leukemia (1)
- life on Mars (1)
- life-detection (1)
- linguistic variable (1)
- linguistic variables (1)
- lipid (1)
- liquid chromatography (1)
- long interspersed nuclear element-1 (1)
- lung cancer (1)
- lymphocytic (1)
- mTOR (1)
- major histocompatibility complex class I polypeptide-related sequence A (MICA) (1)
- massive parallel sequencing (1)
- member D (NKG2D) (1)
- metabolic acidosis (1)
- metabolic effects (1)
- metabolically active cells (1)
- methylmalonic acidaemia (1)
- methylmalonic acidemia (1)
- microbial community structure (1)
- microbial ecology (1)
- microbiome (1)
- microbiome analyses (1)
- microdialysis (1)
- micromanipulation (1)
- mitochondrial biogenesis (1)
- mixed reality (1)
- mixed-mode chromatography (1)
- molecular docking (1)
- molecular dynamics simulations (1)
- molecular motor (1)
- momentary frequency (1)
- monoclonal antibody (1)
- mp2 (1)
- multiple myeloma (1)
- multiple myeloma (MM) (1)
- mutation (1)
- myogenesis (1)
- natural killer group 2 (1)
- next generation sequencing (1)
- non-apoptotic roles (1)
- non-small cell lung cancer (1)
- nonlinear storytelling (1)
- nosocomial infections (1)
- nucleic acids (1)
- nutrient germinants (1)
- octane (1)
- optimized geometries (1)
- organic acid analysis (1)
- organische Schmauchspur (1)
- outer space (1)
- paediatric clinical genetics & dysmorphology (1)
- paediatric endocrinology (1)
- paediatric intensive & critical care (1)
- panspermia (1)
- pathogen control (1)
- pathophysiology (1)
- peptide sequencing (1)
- pharmacokinetics (1)
- phenylketonuria (1)
- phosphoethanolamine (1)
- photometry (1)
- pigments (1)
- planetary protection (1)
- porphyria (1)
- power stroke (1)
- primary airway epithelial cells (1)
- probiotic cleaning (1)
- probiotic-based cleaning formulations (1)
- proliferation (1)
- propan-2-ol (1)
- propionic acidaemia (1)
- propionic acidemia (1)
- protein microarray (1)
- proteomics (1)
- proximal tubule (1)
- pseudogene (1)
- pyridoxal phosphate (1)
- qPCR (1)
- quantum mechanics (1)
- radiation (1)
- radioresistance (1)
- real-time PCR (1)
- recurrent ketoacidotic episodes (1)
- renal cancer (1)
- renal cell carcinoma (1)
- renal tubular cells (1)
- resistance (1)
- retinal degeneration (1)
- rheumatoid arthritis (1)
- rodent (1)
- rodents (1)
- sCD21 (1)
- screening (1)
- see-through display (1)
- selectivity tuning (1)
- sensitize (1)
- sequencing (1)
- sexual assault (1)
- short tandem repeat (1)
- short tandem repeat (STR) (1)
- sirtuins (1)
- skin cancer (1)
- small molecule (1)
- sodium self-inhibition (1)
- solute carrier (1)
- space radiation environment (1)
- sperm cell (1)
- spore resistance (1)
- sporegermination (1)
- stationary phase (1)
- story authoring (1)
- structural biology (1)
- superficially porous particles (1)
- surface sanitization (1)
- surface topography (1)
- surrogate endpoint (1)
- survival (1)
- system optimization (1)
- tRNA processing (1)
- temporomandibular joint (1)
- therapy (1)
- thermophoresis (1)
- tiglyglycine (1)
- time series processing (1)
- transient kinetics (1)
- transient receptor potential vanilloid Type 2 (1)
- triiodothyronine (1)
- tumor microenvironment (1)
- tumor-infiltrating immune cells (1)
- two-electrode voltage clamp (1)
- unfolded protein response (1)
- unfolded protein response (UPR) (1)
- valine catabolic pathway (1)
- valine degradation (1)
- van Deemter curve (1)
- water dimer (1)
- water-to-land transition (1)
- whole genome amplification (WGA) (1)
- whole-exome sequencing (1)
- µCT (1)
- β-catenin (1)
- β-cells (1)
- γ-glutamyl cycle (1)
Pitfalls of using sequence databases for heterologous expression studies - a technical review
(2023)
Synthesis of DNA fragments based on gene sequences available in public resources has become an efficient and affordable method that gradually replaced traditional cloning efforts such as PCR cloning from cDNA. However, database entries based on genome sequencing results are prone to errors which can lead to false sequence information and, ultimately, errors in functional characterization of proteins such as ion channels and transporters in heterologous expression systems. We have identified five common problems that repeatedly appear in public resources: 1) Not every gene has yet been annotated; 2) Not all gene annotations are necessarily correct; 3) Transcripts may contain automated corrections; 4) There are mismatches between gene, mRNA, and protein sequences; and 5) Splicing patterns often lack experimental validation. This technical review highlights and provides a strategy to bypass these issues in order to avoid critical mistakes that could impact future studies of any gene/protein of interest in heterologous expression systems. Abstract figure legend Projects involving heterologous gene expression are often characterised by similar steps. Initially, database research (A) is necessary to retrieve information of full of partial sequences of a gene of interest. A multitude of genome assemblies are annotated and deposited in public databases or that are available for refined search options using individual sequence information. The search results need to be scrutinised and compared to already available information (B). Once the sequence has been determined, DNA synthesis (C) by PCR or commercial synthesis are necessary for further cloning procedures (D). Eventually, the DNA needs to be transfected (E) and expressed in, e.g., eukaryotic cells (F). Finally, the expression of the gene of interest needs to be documented and its function analysed (G). This article is protected by copyright. All rights reserved.
PURPOSE
Cervical cancer (CC) is caused by a persistent high-risk human papillomavirus (hrHPV) infection. The cervico-vaginal microbiome may influence the development of (pre)cancer lesions. Aim of the study was (i) to evaluate the new CC screening program in Germany for the detection of high-grade CC precursor lesions, and (ii) to elucidate the role of the cervico-vaginal microbiome and its potential impact on cervical dysplasia.
METHODS
The microbiome of 310 patients referred to colposcopy was determined by amplicon sequencing and correlated with clinicopathological parameters.
RESULTS
Most patients were referred for colposcopy due to a positive hrHPV result in two consecutive years combined with a normal PAP smear. In 2.1% of these cases, a CIN III lesion was detected. There was a significant positive association between the PAP stage and Lactobacillus vaginalis colonization and between the severity of CC precursor lesions and Ureaplasma parvum.
CONCLUSION
In our cohort, the new cervical cancer screening program resulted in a low rate of additional CIN III detected. It is questionable whether these cases were only identified earlier with additional HPV testing before the appearance of cytological abnormalities, or the new screening program will truly increase the detection rate of CIN III in the long run. Colonization with U. parvum was associated with histological dysplastic lesions. Whether targeted therapy of this pathogen or optimization of the microbiome prevents dysplasia remains speculative.
Forensic DNA profiles are established by multiplex PCR amplification of a set of highly variable short tandem repeat (STR) loci followed by capillary electrophoresis (CE) as a means to assign alleles to PCR products of differential length. Recently, CE analysis of STR amplicons has been supplemented by high-throughput next generation sequencing (NGS) techniques that are able to detect isoalleles bearing sequence polymorphisms and allow for an improved analysis of degraded DNA. Several such assays have been commercialised and validated for forensic applications. However, these systems are cost-effective only when applied to high numbers of samples. We report here an alternative, cost-efficient shallow-sequence output NGS assay called maSTR assay that, in conjunction with a dedicated bioinformatics pipeline called SNiPSTR, can be implemented with standard NGS instrumentation. In a back-to-back comparison with a CE-based, commercial forensic STR kit, we find that for samples with low DNA content, with mixed DNA from different individuals, or containing PCR inhibitors, the maSTR assay performs equally well, and with degraded DNA is superior to CE-based analysis. Thus, the maSTR assay is a simple, robust and cost-efficient NGS-based STR typing method applicable for human identification in forensic and biomedical contexts.
Isovaleric acidemia (IVA), due to isovaleryl-CoA dehydrogenase (IVD) deficiency, results in the accumulation of isovaleryl-CoA, isovaleric acid and secondary metabolites. The increase in these metabolites decreases mitochondrial energy production and increases oxidative stress. This contributes to the neuropathological features of IVA. A general assumption in the literature exists that glycine N-acyltransferase (GLYAT) plays a role in alleviating the symptoms experienced by IVA patients through the formation of N-isovalerylglycine. GLYAT forms part of the phase II glycine conjugation pathway in the liver and detoxifies excess acyl-CoA’s namely benzoyl-CoA. However, very few studies support GLYAT as the enzyme that conjugates isovaleryl-CoA to glycine. Furthermore, GLYATL1, a paralogue of GLYAT, conjugates phenylacetyl-CoA to glutamine. Therefore, GLYATL1 might also be a candidate for the formation of N-isovalerylglycine. Based on the findings from the literature review, we proposed that GLYAT or GLYATL1 can form N-isovalerylglycine in IVA patients. To test this hypothesis, we performed an in-silico analysis to determine which enzyme is more likely to conjugate isovaleryl-CoA with glycine using AutoDock Vina. Thereafter, we performed in vitro validation using purified enzyme preparations. The in-silico and in vitro findings suggested that both enzymes could form N-isovaleryglycine albeit at lower affinities than their preferred substrates. Furthermore, an increase in glycine concentration does not result in an increase in N-isovalerylglycine formation. The results from the critical literature appraisal, in-silico, and in vitro validation, suggest the importance of further investigating the reaction kinetics and binding behaviors between these substrates and enzymes in understanding the pathophysiology of IVA.
Indoor spaces exhibit microbial compositions that are distinctly dissimilar from one another and from outdoor spaces. Unique in this regard, and a topic that has only recently come into focus, is the microbiome of hospitals. While the benefits of knowing exactly which microorganisms propagate how and where in hospitals are undoubtedly beneficial for preventing hospital-acquired infections, there are, to date, no standardized procedures on how to best study the hospital microbiome. Our study aimed to investigate the microbiome of hospital sanitary facilities, outlining the extent to which hospital microbiome analyses differ according to sample-preparation protocol. For this purpose, fifty samples were collected from two separate hospitals—from three wards and one hospital laboratory—using two different storage media from which DNA was extracted using two different extraction kits and sequenced with two different primer pairs (V1–V2 and V3–V4). There were no observable differences between the sample-preservation media, small differences in detected taxa between the DNA extraction kits (mainly concerning Propionibacteriaceae), and large differences in detected taxa between the two primer pairs V1–V2 and V3–V4. This analysis also showed that microbial occurrences and compositions can vary greatly from toilets to sinks to showers and across wards and hospitals. In surgical wards, patient toilets appeared to be characterized by lower species richness and diversity than staff toilets. Which sampling sites are the best for which assessments should be analyzed in more depth. The fact that the sample processing methods we investigated (apart from the choice of primers) seem to have changed the results only slightly suggests that comparing hospital microbiome studies is a realistic option. The observed differences in species richness and diversity between patient and staff toilets should be further investigated, as these, if confirmed, could be a result of excreted antimicrobials.
The Concordia Research Station provides a unique location for preparatory activities for future human journey to Mars, to explore microbial diversity at subzero temperatures, and monitor the dissemination of human-associated microorganisms within the pristine surrounding environment. Amplicon sequencing was leveraged to investigate the microbial diversity of surface snow samples collected monthly over a two-year period, at three distances from the Station (10, 500, and 1000 m). Even when the extracted total DNA was below the detection limit, 16S rRNA gene sequencing was successfully performed on all samples, while 18S rRNA was amplified on 19 samples out of 51. No significant relationships were observed between microbial diversity and seasonality (summer or winter) or distance from the Concordia base. This suggested that if present, the anthropogenic impact should have been below the detectable limit. While harboring low microbial diversity, the surface snow samples were characterized by heterogeneous microbiomes. Ultimately, our study corroborated the use of DNA sequencing-based techniques for revealing microbial presence in remote and hostile environments, with implications for Planetary Protection during space missions and for life-detection in astrobiology relevant targets.
The cystic fibrosis transmembrane conductance regulator (CFTR) anion channel and the epithelial Na+ channel (ENaC) play essential roles in transepithelial ion and fluid transport in numerous epithelial tissues. Inhibitors of both channels have been important tools for defining their physiological role in vitro. However, two commonly used CFTR inhibitors, CFTRinh-172 and GlyH-101, also inhibit non-CFTR anion channels, indicating they are not CFTR specific. However, the potential off-target effects of these inhibitors on epithelial cation channels has to date not been addressed. Here, we show that both CFTR blockers, at concentrations routinely employed by many researchers, caused a significant inhibition of store-operated calcium entry (SOCE) that was time-dependent, poorly reversible and independent of CFTR. Patch clamp experiments showed that both CFTRinh-172 and GlyH-101 caused a significant block of Orai1-mediated whole cell currents, establishing that they likely reduce SOCE via modulation of this Ca2+ release-activated Ca2+ (CRAC) channel. In addition to off-target effects on calcium channels, both inhibitors significantly reduced human αβγ-ENaC-mediated currents after heterologous expression in Xenopus oocytes, but had differential effects on δβγ-ENaC function. Molecular docking identified two putative binding sites in the extracellular domain of ENaC for both CFTR blockers. Together, our results indicate that caution is needed when using these two CFTR inhibitors to dissect the role of CFTR, and potentially ENaC, in physiological processes.
SLC6A14 (ATB0,+) is unique among SLC proteins in its ability to transport 18 of the 20 proteinogenic (dipolar and cationic) amino acids and naturally occurring and synthetic analogues (including anti-viral prodrugs and nitric oxide synthase (NOS) inhibitors). SLC6A14 mediates amino acid uptake in multiple cell types where increased expression is associated with pathophysiological conditions including some cancers. Here, we investigated how a key position within the core LeuT-fold structure of SLC6A14 influences substrate specificity. Homology modelling and sequence analysis identified the transmembrane domain 3 residue V128 as equivalent to a position known to influence substrate specificity in distantly related SLC36 and SLC38 amino acid transporters. SLC6A14, with and without V128 mutations, was heterologously expressed and function determined by radiotracer solute uptake and electrophysiological measurement of transporter-associated current. Substituting the amino acid residue occupying the SLC6A14 128 position modified the binding pocket environment and selectively disrupted transport of cationic (but not dipolar) amino acids and related NOS inhibitors. By understanding the molecular basis of amino acid transporter substrate specificity we can improve knowledge of how this multi-functional transporter can be targeted and how the LeuT-fold facilitates such diversity in function among the SLC6 family and other SLC amino acid transporters.
Cytokine-induced killer cells (CIK) in combination with dendritic cells (DCs) have shown favorable outcomes in renal cell carcinoma (RCC), yet some patients exhibit recurrence or no response to this therapy. In a broader perspective, enhancing the antitumor response of DC-CIK cells may help to address this issue. Considering this, herein, we investigated the effect of anti-CD40 and anti-CTLA-4 antibodies on the antitumor response of DC-CIK cells against RCC cell lines. Our analysis showed that, a) anti-CD40 antibody (G28.5) increased the CD3+CD56+ effector cells of CIK cells by promoting the maturation and activation of DCs, b) G28.5 also increased CTLA-4 expression in CIK cells via DCs, but the increase could be hindered by the CTLA-4 inhibitor (ipilimumab), c) adding ipilimumab was also able to significantly increase the proportion of CD3+CD56+ cells in DC-CIK cells, d) anti-CD40 antibodies predominated over anti-CTLA-4 antibodies for cytotoxicity, apoptotic effect and IFN-g secretion of DC-CIK cells against RCC cells, e) after ipilimumab treatment, the population of Tregs in CIK cells remained unaffected, but ipilimumab combined with G28.5 significantly reduced the expression of CD28 in CIK cells. Taken together, we suggest that the agonistic anti-CD40 antibody rather than CTLA-4 inhibitor may improve the antitumor response of DC-CIK cells, particularly in RCC. In addition, we pointed towards the yet to be known contribution of CD28 in the crosstalk between anti-CTLA-4 and CIK cells.
While many proteins are known clients of heat shock protein 90 (Hsp90), it is unclear whether the transcription factor, thyroid hormone receptor beta (TRb), interacts with Hsp90 to control hormonal perception and signaling. Higher Hsp90 expression in mouse fibroblasts was elicited by the addition of triiodothyronine (T3). T3 bound to Hsp90 and enhanced adenosine triphosphate (ATP) binding of Hsp90 due to a specific binding site for T3, as identified by molecular docking experiments. The binding of TRb to Hsp90 was prevented by T3 or by the thyroid mimetic sobetirome. Purified recombinant TRb trapped Hsp90 from cell lysate or purified Hsp90 in pull-down experiments. The affinity of Hsp90 for TRb was 124 nM. Furthermore, T3 induced the release of bound TRb from Hsp90, which was shown by streptavidin-conjugated quantum dot (SAv-QD) masking assay. The data indicate that the T3 interaction with TRb and Hsp90 may be an amplifier of the cellular stress response by blocking Hsp90 activity.
Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC50 of 50 μM. The binding motif can influence the activity of Hsp90 by hindering ATP accessibility or the release of ADP.
When the Artemis missions launch, NASA's Orion spacecraft (and crew as of the Artemis II mission) will be exposed to the deep space radiation environment beyond the protection of Earth's magnetosphere. Hence, it is essential to characterize the effects of space radiation, microgravity, and the combination thereof on cells and organisms, i.e., to quantify any correlations between the deep space radiation environment, genetic variation, and induced genetic changes in cells. To address this, the Artemis I mission will include the Peristaltic Laboratory for Automated Science with Multigenerations (PLASM) hardware containing the Deep Space Radiation Genomics (DSRG) experiment. The scientific aims of DSRG are (i) to identify the metabolic and genomic pathways in yeast affected by microgravity, space radiation, and their combination, and (ii) to differentiate between gravity and radiation exposure on single-gene deletion/overexpressing strains' ability to thrive in the spaceflight environment. Yeast is used as a model system because 70% of its essential genes have a human homolog, and over half of these homologs can functionally replace their human counterpart. As part of the experiment preparation towards spaceflight, an Experiment Verification Test (EVT) was performed at the Kennedy Space Center to verify that the experiment design, hardware, and approach to automated operations will enable achieving the scientific aims. For the EVT, fluidic systems were assembled, sterilized, loaded, and acceptance-tested, and subsequently integrated with the engineering parts to produce a flight-like PLASM unit. Each fluidic system consisted of (i) a Media Bag, (ii) four Culture Bags loaded with Saccharomyces cerevisiae (two with deletion series and the remaining two with overexpression series), and (iii) tubing and check valves. The EVT PLASM unit was put under a temperature profile replicating the anticipated different phases of flight, including handover to launch, spaceflight, and splashdown to handover back to the science team, for a 58-day period. At EVT completion, the rate of activation, cellular growth, RNA integrity, and sample contamination were interrogated. All of the experiment's success criteria were satisfied, encouraging our efforts to perform this investigation on Artemis I. This manuscript thus describes the process of spaceflight experiment design maturation with a focus on the EVT, its results, DSRG's preparation for its planned launch on Artemis I in 2022, and how the PLASM hardware can enable other scientific goals on future Artemis missions and/or the Lunar Orbital Platform – Gateway.
Modern PCR-based analytical techniques have reached sensitivity levels that allow for obtaining complete forensic DNA profiles from even tiny traces containing genomic DNA amounts as small as 125 pg. Yet these techniques have reached their limits when it comes to the analysis of traces such as fingerprints or single cells. One suggestion to overcome these limits has been the usage of whole genome amplification (WGA) methods. These methods aim at increasing the copy number of genomic DNA and by this means generate more template DNA for subsequent analyses. Their application in forensic contexts has so far remained mostly an academic exercise, and results have not shown significant improvements and even have raised additional analytical problems. Until very recently, based on these disappointments, the forensic application of WGA seems to have largely been abandoned. In the meantime, however, novel improved methods are pointing towards a perspective for WGA in specific forensic applications. This review article tries to summarize current knowledge about WGA in forensics and suggests the forensic analysis of single-donor bioparticles and of single cells as promising applications.
Background: Cancer heterogeneity poses a serious challenge concerning the toxicity and adverse effects of therapeutic inhibitors, especially when it comes to combinatorial therapies that involve multiple targeted inhibitors. In particular, in non-small cell lung cancer (NSCLC), a number of studies have reported synergistic effects of drug combinations in the preclinical models, while they were only partially successful in the clinical setup, suggesting those alternative clinical strategies (with genetic background and immune response) should be considered. Herein, we investigated the antitumor effect
of cytokine-induced killer (CIK) cells in combination with ALK and PD-1 inhibitors in vitro on genetically variable NSCLC cell lines.
Methods: We co-cultured the three genetically different NSCLC cell lines NCI-H2228 (EML4-ALK), A549 (KRAS mutation), and HCC-78 (ROS1 rearrangement) with and without nivolumab (PD-1 inhibitor) and crizotinib (ALK inhibitor). Additionally, we profiled the variability of surface expression multiple immune checkpoints, the concentration of absolute dead cells, intracellular granzyme B on CIK cells using flow cytometry as well as RT-qPCR. ELISA and Western blot were performed to verify the activation of CIK cells.
Results: Our analysis showed that (a) nivolumab significantly weakened PD-1 surface expression on CIK cells without impacting other immune checkpoints or PD-1 mRNA expression, (b) this combination strategy showed an effective response on cell viability, IFN-g production, and intracellular release of granzyme B in CD3+ CD56+ CIK cells, but solely in NCI-H2228, (c) the intrinsic expression of Fas ligand (FasL) as a T-cell activation marker in CIK cells was upregulated by this additive effect, and (d) nivolumab induced Foxp3 expression in CD4+CD25+ subpopulation of CIK cells significantly increased. Taken together, we could show that CIK cells in combination with crizotinib and nivolumab can enhance the anti-tumor immune response through FasL activation, leading to increased IFN-g and granzyme B, but only in NCI-H2228 cells with EML4-ALK rearrangement. Therefore, we hypothesize that CIK therapy may be a potential alternative in NSCLC patients harboring EML4-ALK rearrangement, in addition, we support the idea that combination therapies offer significant potential when they are optimized on a patient-by-patient basis.