Refine
H-BRS Bibliography
- yes (766) (remove)
Departments, institutes and facilities
- Fachbereich Angewandte Naturwissenschaften (766) (remove)
Document Type
- Article (531)
- Conference Object (76)
- Part of a Book (65)
- Doctoral Thesis (26)
- Book (monograph, edited volume) (21)
- Report (20)
- Preprint (9)
- Contribution to a Periodical (6)
- Research Data (4)
- Conference Proceedings (2)
Year of publication
Keywords
- GC/MS (13)
- Lignin (13)
- Lehrbuch (8)
- cytokine-induced killer cells (8)
- lignin (8)
- immunotherapy (7)
- stem cells (7)
- Chemie (6)
- Chemometrics (6)
- drug release (6)
- Biomass (5)
- Chromatography (5)
- Explosives (5)
- Gene expression (5)
- Organic aciduria (5)
- Polymers (5)
- biomaterial (5)
- osteogenesis (5)
- scaffolds (5)
- Analytical pyrolysis (4)
- CD21 (4)
- Corrosion inhibitors (4)
- ENaC (4)
- Inborn error of metabolism (4)
- Ketolysis (4)
- Mass spectrometry (4)
- Mesenchymal stem cells (4)
- Miscanthus (4)
- Regenerative medicine (4)
- Scaffolds (4)
- Tissue engineering (4)
- active packaging (4)
- additive (4)
- angiogenesis (4)
- antioxidant (4)
- apoptosis (4)
- mesenchymal stem cells (4)
- organic aciduria (4)
- organosolv (4)
- pioglitazone (4)
- thiazolidinediones (4)
- tissue engineering (4)
- Analytische Chemie (3)
- Antimicrobial activity (3)
- Antioxidant activity (3)
- Arthritis (3)
- Composites (3)
- Crystallinity (3)
- DNA damage (3)
- DNA typing (3)
- Dielectric analysis (3)
- Failure analysis (3)
- Glycine conjugation (3)
- Isovaleric acidemia (3)
- K/BxN (3)
- Ketogenesis (3)
- Ketone body (3)
- Kriminalistik (3)
- Malaria (3)
- Metabolic acidosis (3)
- Miscanthus x giganteus (3)
- Molecular dynamics (3)
- NMR (3)
- Plasmodium (3)
- Primary long-chain alkyl amines (3)
- Pyrolysis (3)
- Raman spectroscopy (3)
- SERS (3)
- Stem cells (3)
- TD-GC/MS (3)
- alumina (3)
- autophagy (3)
- biomass (3)
- bone (3)
- bone tissue engineering (3)
- chemometrics (3)
- classification (3)
- cytokine-induced killer (CIK) cells (3)
- differentiation (3)
- extraction (3)
- extremophiles (3)
- extrusion blow molding (3)
- hydrogel (3)
- insulin resistance (3)
- metabolic acidosis (3)
- poly(lactic acid) (3)
- preceramic paper (3)
- scaffold (3)
- shedding (3)
- sustainability (3)
- type 2 diabetes (3)
- ultrapure water (3)
- 3-hydroxyisobutyrate dehydrogenase (2)
- 3-hydroxyisobutyric aciduria (2)
- ACAT1 (2)
- AOP (2)
- Additiv (2)
- Additives (2)
- Adipose tissue (2)
- Aluminiumoxid (2)
- Aminoacylase (2)
- Analytical Chemistry (2)
- Analytics (2)
- Analytik (2)
- Anoplophora glabripennis (2)
- Antioxidans (2)
- Antioxidant capacity (2)
- Automotive industry (2)
- B cell activation (2)
- Biomaterials (2)
- Biomineralization (2)
- Bone (2)
- CIK cells (2)
- Canavan disease (2)
- Cathepsin K (2)
- Classification (2)
- Complement receptor (2)
- Complement receptor 2/CD21 (2)
- Complex modulus (2)
- Cysteine proteases (2)
- DMA (2)
- DNA (2)
- DSC (2)
- Dental follicle (2)
- Deoxyhypusine hydroxylase (2)
- Diabetes (2)
- Differentiation (2)
- Discriminant analysis (2)
- Engineering (2)
- Enzyme activity (2)
- Extrusion blow molding (2)
- Fatty acid metabolism (2)
- Folin-Ciocalteu assay (2)
- GC-FID/NPD (2)
- GLYCTK (2)
- Glycine N-acyltransferase (2)
- Graphene (2)
- HIBADH (2)
- HIBADH deficiency (2)
- HMGCL (2)
- HPLC (2)
- HSQC NMR (2)
- Humans (2)
- Hyperspectral image (2)
- IR microspectroscopy (2)
- Ion viscosity (2)
- Ketoacidosis (2)
- Ketone body utilization (2)
- Kinetics (2)
- Lignocellulose feedstock (2)
- Mars (2)
- Massenspektrometrie (2)
- Membrane Transport (2)
- Metabolic decompensation (2)
- Microorganisms (2)
- Mxi-2 (2)
- NMR spectroscopy (2)
- Nano-Systems (2)
- Organic acids (2)
- Organosolv lignin (2)
- Osteogenesis (2)
- Oxidative stress (2)
- Polymorphism (2)
- Principal Components Analysis (2)
- Prognosis (2)
- Pten (2)
- Py-EGA-MS (2)
- R-ratio (2)
- Raman microscopy (2)
- Raman-microspectroscopy (2)
- Renewable resource (2)
- Resins (2)
- Rheumatoid arthritis (2)
- SLC (2)
- Shedding (2)
- Short tandem repeat (STR) (2)
- Spectroscopy (2)
- Spektroskopie (2)
- Styrene (2)
- Sweet cherry (Prunus avium L.) (2)
- TNT (2)
- TOC (2)
- Thyme (2)
- Thymian (2)
- Type 2 diabetes mellitus (2)
- UV (2)
- VOC (2)
- Western Africa (2)
- Whole genome amplification (2)
- adhesion (2)
- aluminum bonding wire (2)
- antimicrobial activity (2)
- antioxidant activity (2)
- azadipeptide nitrile (2)
- bacteria (2)
- bio-based polymers (2)
- biobased (2)
- bioeconomy (2)
- blown film extrusion (2)
- bone regeneration (2)
- breast cancer (2)
- bulk detection (2)
- cardiovascular disease (2)
- cardiovascular risk (2)
- cell death (2)
- cell migration (2)
- coniferous woods (2)
- creep (2)
- cyanohydrazide warhead (2)
- cysteine proteases (2)
- d-Glycerate kinase deficiency (2)
- d-Glyceric aciduria (2)
- dielectric analysis (2)
- diffusion (2)
- discriminant analysis (2)
- essential oil (2)
- evolution (2)
- extraterrestrial analogue (2)
- extremophile (2)
- food loss (2)
- food waste (2)
- food-related bacteria (2)
- force generation (2)
- fruit quality (2)
- fungi (2)
- gas sensor (2)
- gas sensors (2)
- glimepiride (2)
- human cathepsins (2)
- identification (2)
- image fusion (2)
- improvised explosive devices (2)
- inborn error of metabolism (2)
- isoleucine (2)
- ketogenesis (2)
- ketolysis (2)
- ketone body (2)
- kraft lignin (2)
- leucine (2)
- library free detection (2)
- life detection (2)
- lifetime prediction (2)
- lignocellulose feedstock (2)
- low-input crops (2)
- mechanical properties (2)
- melanin (2)
- metabolic decompensation (2)
- migration (2)
- modeling (2)
- monolignol ratio (2)
- morphology (2)
- multivariate data processing (2)
- myosin (2)
- natural additives (2)
- nitrile inhibitors (2)
- osteoblast (2)
- osteoclast (2)
- ozonation (2)
- ozone (2)
- pansharpening (2)
- paper-derived ceramic (2)
- permeability (2)
- photolysis (2)
- photonic sensing (2)
- physical sensors (2)
- plant extracts (2)
- poly(butylene adipate terephthalate) (2)
- polymers (2)
- polyphenols (2)
- power electronics (2)
- pressure sensitive adhesives (2)
- protease inhibitor (2)
- reaction kinetics (2)
- rheology (2)
- shelf life (2)
- small-scale fatigue testing (2)
- stem cell (2)
- stress response (2)
- structure (2)
- sulfonylurea (2)
- sustainable packaging (2)
- thermo-mechanical properties (2)
- total phenol content (2)
- transdermal therapeutic systems (2)
- type 2 diabetes mellitus (2)
- (poly)saccharides (1)
- 1-MCP (1)
- 16S rRNA gene sequencing (1)
- 1H (1)
- 2B4 (1)
- 3-hydroxy-n-butyric acid (1)
- 3-hydroxyisobutyrate dehydrogenase deficiency (1)
- 3-hydroxyisobutyric acid dehydrogenase deficiency (1)
- 31P NMR (1)
- 3D activity landscapes (1)
- 3D-printing (1)
- 5-Oxoprolinase (1)
- 5-oxoprolinuria (1)
- ABTS (1)
- ACacylcarnitines (1)
- ADP release (1)
- AMAtypical myopathy (1)
- AMT (1)
- APC superfamily (1)
- ASIC (1)
- ASPA (1)
- ASR (1)
- ATB0,+ (1)
- ATF4 (1)
- ATF6 (1)
- ATPase cycle (1)
- ATR-FTIR (1)
- Abies nordmanniana (1)
- Abies procera (1)
- Abiotic stress (1)
- Acceleration (1)
- Accuracy (1)
- Acetylcholinesterase (AChE) (1)
- Acorns (1)
- Active site mapping (1)
- Activity-based probes (1)
- Acylpeptide hydrolase (1)
- Additive (1)
- Adipogenesis (1)
- Adipogenic effect (1)
- Adipose tissue-derived stem cells (1)
- AdoMETDC (1)
- Adsorption (1)
- Adult Stem Cells/physiology (1)
- Affinity proteomics (1)
- Agarose (1)
- Age estimation (1)
- Agglomerative Hierarchical Cluster Analysis (1)
- Aglaonema hookerianum (1)
- Ago2 (1)
- Aloe vera (1)
- Alzheimer’s disease (1)
- Aminoacylase 1 (1)
- Amplifiers (1)
- Amylose stationary phases (1)
- Analytics Internship (1)
- Analytik Praktikum (1)
- Angiogenesis (1)
- Ankle Joint (1)
- Ankle thickness (1)
- Antarctic Polar Plateau (1)
- Antarctic ice sheet (1)
- Anti-inflammatory effects (1)
- Antibodies* (1)
- Antibody Induced Arthritis (1)
- Antidepressant (1)
- Antioxidant assays (1)
- Antioxidanz (1)
- Antioxidative Capacity (1)
- Antioxidatives Potential (1)
- Antiphospholipid syndrome (APS) (1)
- Anxiolytic (1)
- Apheresis therapy (1)
- Aphrodisiac effects (1)
- Apple replant disease (1)
- Area under the curve (1)
- Articular Cartilage (1)
- Aspartic acid racemization (1)
- Aspartoacylase (1)
- Assay development (1)
- Assay reproducibility (1)
- Asymmetric cell division (1)
- Atherosclerosis (1)
- Atlantic coast (1)
- AuNPs (1)
- Aufgabensammlung (1)
- Autism (1)
- Autoantibody (1)
- Automated Coating (1)
- Automated PyMS (1)
- Automation (1)
- Automobilindustrie (1)
- Automotive Industry (1)
- Autophagy induction (1)
- B Defects (1)
- B Interfaces (1)
- B cells (1)
- B lymphocyte (1)
- BLAST (1)
- Bacillus (1)
- Bacteria (1)
- Bacteria, Anaerobic (1)
- Bactericidal effect (1)
- Bakterien (1)
- Basiswerkstoff (1)
- BcL-2 family (1)
- Bcl-2 (1)
- Beech wood (1)
- Benzoyl-coenzym A (1)
- Beta-ketothiolase (1)
- Beta-ketothiolase deficiency (1)
- Biaxiality (1)
- BioMark HD microfluidic system (1)
- Bioactive (1)
- Bioactive factors (1)
- Bioactivity (1)
- Bioaktiv (1)
- Bioaktive Verbindung (1)
- Bioaktivität (1)
- Bioassay (1)
- Biobased polymeric material (1)
- Biochemicals (1)
- Biochemische Analyse (1)
- Bioenergy (1)
- Biokompatibilität (1)
- Biological databases (1)
- Biological therapy (1)
- Bioluminescence (1)
- Biomarkers stability (1)
- Biomasse (1)
- Biomaterial (1)
- Biomaterialien (1)
- Biophysics (1)
- Biopolymers (1)
- Biorefinery (1)
- Biosignatures (1)
- Blood glucose meter (1)
- Bond strength (1)
- Bone marrow-derived stem cells (1)
- Breast cancer (1)
- Bulk detection (1)
- Bulk fill (1)
- C-19 steroid (1)
- CD146 (1)
- CD30+ cells (1)
- CD40 (1)
- CD40, CTLA-4 (1)
- CDH1 (1)
- CDKN1B (1)
- CFTR inhibitors (1)
- CFTR mutations (1)
- CIK-Zellen (1)
- CR2 (1)
- CTNNB1 (1)
- CYP2C19 (1)
- CYP2C8 variants (1)
- CYP2C9 (1)
- CYP2D6 (1)
- Caffeine-containing drinks (1)
- Calcium (1)
- Calcium Intracellular Release (1)
- Calorimetry (1)
- Camphorquinone (1)
- Cancer (1)
- Cannabinoids (1)
- Canola (1)
- Carbapenem (1)
- Carbon nanotubes (1)
- Carboxen-poly(dimethylsiloxane) (1)
- Carboxy-terminal fragments (1)
- Cardiovascular Disease (1)
- Cartilage Destruction (1)
- Catalyst Ink (1)
- Catalyst Layer (1)
- Catechins (1)
- Cathepsin B (1)
- Cathepsin S (1)
- Cathepsins (1)
- Cavities (1)
- Cell Cycle (1)
- Cell Differentiation (1)
- Cell Differentiation/physiology (1)
- Cell Signaling (1)
- Cell activation (1)
- Cell lineage (1)
- Cellulose (1)
- Cellulose stationary phases (1)
- Central sensitisation (1)
- Cervical cancer screening (1)
- Cervicovaginal microbiome (1)
- Chaetocin (1)
- Charakterisierung (1)
- Chemical calculations (1)
- Chemical imaging (1)
- Chemical resource (1)
- Chemical structure (1)
- Chemicals (1)
- Chemische Analyse (1)
- Chemometrie (1)
- Chemotherapy (1)
- Chiral stationary phases (1)
- Chiral-nematischer Flüssigkristall (1)
- Chlorophyll fluorescence (1)
- Christmas trees (1)
- Chromatogramm (1)
- Chromatographie (1)
- Chromatographische Analyse, Elektrophorese (1)
- Chronic lymphocytic leukemia (1)
- Cislunar (1)
- Climate change (1)
- Collagen (1)
- Collision induced dissociation (1)
- Color/Spot-Test (1)
- Colposcopy (1)
- Complement (1)
- Complement receptor 2 (1)
- Complement receptor 2 /CD21 (1)
- Composite resin (1)
- Compressive strength (1)
- Confocal microscopy (1)
- Corrosion protction (1)
- Coumarins (1)
- Crack formation (1)
- Cucumber peel waste (1)
- Curie-point pyrolysis (1)
- Curing behavior (1)
- Curing depth (1)
- Curing kinetics (1)
- Cytokine (1)
- Cytokine-induced killer (CIK) cells (1)
- D Multilayer (1)
- D Nickel alloy (1)
- D Zirconium oxide (1)
- DBSdried blot spots (1)
- DIDMOAD (1)
- DMFC (1)
- DNA Transcription (1)
- DNA double- strand breaks (1)
- DNA extraction protocols (1)
- DNA interaction (1)
- DNA methylation (1)
- DNA profile (1)
- DNA profiling (1)
- DOSY (1)
- DPPH (1)
- Daptomycin (1)
- Data fusion (1)
- Defense and security (1)
- Degradation (1)
- Degradation products (1)
- Degraded DNA (1)
- Degree of conversion (1)
- Dehydrogenase (1)
- Dental (1)
- Dental composites (1)
- Dental material (1)
- Dental resin (1)
- Depth Of Cure (1)
- Derivatization with trifluoroacetic anhydride (1)
- Desinfektion (1)
- Detektion von Explosivstoffen (1)
- Development (1)
- Diabetes mellitus (1)
- Diaminphenylderivat (1)
- Didaktik (1)
- Dielectric analysis (DEA) (1)
- Differenzierung (1)
- Dimethacrylate (1)
- Diodes (1)
- Diselenide bridge (1)
- Docking (1)
- Draw ratio (1)
- Drug target (1)
- Duroplast (1)
- Dynamic mechanical analysis (1)
- Dystonia (1)
- E-cadherin (1)
- E. coli (1)
- E/I balance (1)
- EIF-5A (1)
- EPS (1)
- ER stress (1)
- ERO1α (1)
- ESKAPEE pathogens (1)
- Echtzeitüberwachung (1)
- Ectodomain shedding (1)
- Effect of post-irradiation curing (1)
- Einführung (1)
- Electrochemical cells (1)
- Electron beam physical vapor deposition (1)
- Elephantiasis (1)
- Elution (1)
- Enantioselective gas chromatography (1)
- Endoplasmatic reticulum (1)
- Endosomes (1)
- Endothelial cells (1)
- Endothelin-1 (1)
- Engineering plastics (1)
- Enzyme activity assays (1)
- Epilepsy (1)
- Epitope mapping: Epitope extraction (1)
- Ernte (1)
- European horse chestnut (1)
- Eutectic Ti-Fe alloys (1)
- Evaluation of curing (1)
- ExoMars (1)
- Expanded polystyrene (EPS) (1)
- Explosivstoff (1)
- Extrusionsblasformen (1)
- FMR1 (1)
- FOXP3 (1)
- FRAP (1)
- FTIR (1)
- Fabry disease (1)
- Fachrechnen (1)
- Familial glioma (1)
- Fatigue crack growth (1)
- Fe-ion radiation (1)
- Fertigation (1)
- Festigkeitslehre (1)
- Festschrift (1)
- Fiber reinforcement (1)
- Fiber-optic probe (1)
- Fibroblast-like synoviocytes (FLS) (1)
- Filler content (1)
- Fingerprint powder (1)
- Flow direction (1)
- Fluorescence-quenched substrates (1)
- Flüssigkristalline Polymere (1)
- Foaming (1)
- Folin-Ciocalteu (1)
- Folin–Ciocalteu assay (1)
- Food intolerance (1)
- Food packaging (1)
- Food security (1)
- Forensic genetics (1)
- Forensic genomics (1)
- Forschung (1)
- Fourier-transform infrared spectroscopy (1)
- Fragile X Syndrome (1)
- Frequenzauswertung (1)
- Fructose (1)
- Furnace pyrolyzer (1)
- Fährverkehr (1)
- GC (1)
- GC-FID (1)
- GC–MS (1)
- GC–MSgas chromatography–mass spectrometry (1)
- GFRP (1)
- GMX1778 (1)
- Galactic Cosmic Rays (GCRs) (1)
- Gas Chromatography (1)
- Gas chromatography-mass spectrometry (1)
- Gas chromatography/ mass spectrometry (1)
- Gas chromatography/mass spectrometry (GC/MS) (1)
- Gas chromatography–mass spectrometry (1)
- Gas sensors (1)
- Gas turbines (1)
- Gasanalyse (1)
- Gaschromatographie (1)
- Gassensor (1)
- Gasturbinenschaufel (1)
- Gelatin Zymography (1)
- Gene Expression Regulation (1)
- Genes (1)
- Genotoxicity (1)
- Genotyp (1)
- Geopolymer (1)
- Geruchssinn (1)
- Ghanaian children (1)
- Glutamin N-phenylacetyltransferase (1)
- Glutathione (1)
- Glutathione synthetase (1)
- Glycerate (1)
- Glyceric aciduria (1)
- Glycin N-acyltransferase (1)
- Glycine N-Acyltransferase (GLYAT) (1)
- Glycogen storage disease type (1)
- Glycopeptides (1)
- Glyzinkonjugation (1)
- Graft material (1)
- Green fluorescent protein (1)
- Growth (1)
- HPLC Optimierung (1)
- HPTLC (1)
- HPV diagnostic (1)
- HS SPME (1)
- HS SPME–GC/MS (1)
- HSD10 (1)
- HSP90 (1)
- Hands-On Learning/Manipulatives (1)
- Hard tissue (1)
- Hardness mapping (1)
- Harnstoffzyklusdefekt (1)
- Hazardous material detection (1)
- Headspace SPME (1)
- Health care policy (1)
- Heparanase (1)
- Heparin (1)
- Heterogenes Sensorsystem (1)
- Hexamethylene triperoxide diamine (HMTD) (1)
- High performance liquid chromatography (1)
- High performance liquid chromatography – mass-spectrometry (HPLC-MS/MS) (1)
- High speed tensile testing (1)
- High strain rate (1)
- High temperature deformation (1)
- High temperature laser powder bed fusion (1)
- Hochschule (1)
- Hochschule Bonn-Rhein-Sieg (1)
- Home made explosives (1)
- Homemade explosives (1)
- Homeobox (1)
- Horner-Wadsworth-Emmons olefination Irreversible inhibition (1)
- Hydraulic cylinders (1)
- Hyperalgesia (1)
- Hyperammonemia (1)
- Hypoglycemia (1)
- Hypusine (1)
- ICP OES (1)
- IED (1)
- IR-microspectroscopy (1)
- IRE1 (1)
- Identification (1)
- Illegal Wildlife Trade (1)
- Immune escape (1)
- Immunoadsorption (1)
- Immunology* (1)
- Impedance spectroscopy (1)
- Improvised explosive devices (1)
- In silico epitope prediction (1)
- In silico modelling (1)
- Inborn errors of metabolism (1)
- Indentation techniques (1)
- Individualisierte Medizin (1)
- Industrial applications (1)
- Infrared (1)
- Infrarot (1)
- Infrarotmikroskopie (1)
- Inherited metabolic disorders (1)
- Inhibitor (1)
- Innovation (1)
- Instrumental analysis (1)
- Instrumentation (1)
- Insulin glulisine (1)
- Intact proinsulin (1)
- Interface (1)
- Introduction (1)
- Ion mobility (1)
- Ionenbeweglichkeitsspektroskopie (1)
- Ionic liquids (1)
- Ionizing radiation (1)
- Irradiance Distribution (1)
- Irradiance distribution (1)
- Isoleucine (1)
- Isoleucine degradation (1)
- Isomers (1)
- Isotherms (1)
- Isovalerianazidämie (1)
- Joint Destruction (1)
- Juvenile arthritis (JA) (1)
- K/BxN mouse model (1)
- K/B×N model (1)
- Kardioprotektion (1)
- Karl Fischer titration (1)
- Ketoasidoz (1)
- Ketogenic diet (1)
- Ketone body synthesis (1)
- Knochenersatz (1)
- Knochenzement (1)
- Knoop micro-hardness (1)
- Koagulation (1)
- Koaxiales Elektrospinnen (1)
- Kozak-sequence (1)
- Kraft lignin (1)
- Kriechen (1)
- Kriminaltechnik (1)
- Kunststoffverpackung (1)
- LC-HRMS (1)
- LC-MS/MS (1)
- LET (1)
- LFA-1 (1)
- LSPR (1)
- Laboratories and Demonstrations (1)
- Lamellae structure (1)
- Lanthanide luminescence (1)
- Laser drilling (1)
- Laser induced breakdown spectroscopy (1)
- Laser-Beam Profiler (1)
- Laserbohren (1)
- Lasermaterialbearbeitung (1)
- Lebensdauervorhersage (1)
- Lebensmittelverpackungen (1)
- Leg (1)
- LeuT (1)
- Leucine (1)
- Leucine degradation (1)
- Lexikon (1)
- Libido-booster (1)
- Ligand -Receptor Interactions* (1)
- Light Curing Units (1)
- Light attenuation (1)
- Light curing (1)
- Light curing units (1)
- Light limitation (1)
- Light measurement (1)
- Lignin-based composites (1)
- Linear viscoelasticity (1)
- Lineare Viskoelastizität (1)
- Linezolid (1)
- Lipoaspirate (1)
- Lipoaspirates (1)
- Liquid crystal (1)
- Liquid-liquid extraction (LLE) (1)
- Lithium (1)
- Local mechanical properties (1)
- Local process-dependent properties (1)
- Locomotion (1)
- Long-chain N-1-alkyl-1,3-propanediamines (1)
- Low-input crops (1)
- Luftfracht (1)
- Lymphedema (1)
- Lysosome (1)
- Lysosomes (1)
- MADDMultiple acyl-CoA dehydrogenase deficiency (1)
- MALDI QIT TOF MS (1)
- MAP (1)
- MAPO (1)
- MCT (1)
- MICA/B (1)
- MMP-9 (1)
- MOCS1 (1)
- MOX Gassensoren (1)
- MOX gas sensors (1)
- MPV17 monoclonal antibody (1)
- MRPP (1)
- MS (1)
- MS/MS peptide sequencing (1)
- MSCs (1)
- Machine learning (1)
- Macrophage (1)
- Macrophage migration inhibitory factor (1)
- Macrophages (1)
- Magnetic resonance imaging (MRI) (1)
- Mal d 1 (1)
- Malus domestica (1)
- Malus genotypes (1)
- Mapping (1)
- Mars environment (1)
- Mars exploration (1)
- Mass Spectrometry (1)
- Mass transport (1)
- Mast cells (1)
- Materialverarbeitung (1)
- Matrix metalloproteases (1)
- Meat-associated Microorganisms (1)
- Mechanical properties of materials (1)
- Mechanische Prüfung (1)
- Mehrachsigkeit (1)
- Mesenchymal Stromal Cells/cytology (1)
- Mesenchymal stromal cells (1)
- Metabolicdecompensation (1)
- Metal oxide gas sensors (1)
- Metals (1)
- Method validation (1)
- Methylation (1)
- Methyltransferase (1)
- Michael acceptors (1)
- Micro-mechanical properties (1)
- Microcirculation (1)
- Microindentation (1)
- Micromanipulation (1)
- Microplastics (1)
- Miscanthus nagara (1)
- Miscanthus robustus (1)
- Miscanthus sinensis (1)
- Mitochondria (1)
- Mitochondrial DNA depletion syndrome (1)
- Mitochondrial apoptogens (1)
- Mitochondrial outer membrane permeabilization (MOMP) (1)
- Mitochondrial tRNA (1)
- Mobile explosive identification (1)
- Moco deficiency (1)
- Mold temperature (1)
- Molecular Dynamics (1)
- Molecular weight (1)
- Molekulargewicht (1)
- Molybdenum cofactor (1)
- Monocarboxylate transporter 1 (1)
- Motion tracking (1)
- Motivation (1)
- Movement disorder (1)
- Multi-lineage differentiation (1)
- Multilineage potential (1)
- Multimodal hyperspectral data (1)
- Multivariate analysis (1)
- N-acetylaspartic acid (1)
- N-acylated amino acids (1)
- N-isovalerylglycine (1)
- NAI (1)
- NDVI (1)
- NFκB pathway (1)
- NGS (1)
- NKG2D (1)
- NLRP3 inflammasome (1)
- NMR-Spektroskopie (1)
- NSS family (1)
- Nachhaltigkeit (1)
- Nachwachsender Rohstoff (1)
- Nadelhölzer (1)
- Nafion™ (1)
- Nano-systems (1)
- Nanofibers (1)
- Nanoparticles (1)
- Native mass spectrometry (1)
- Naturkautschuk (1)
- Near-field synchrotron ptychographic X-ray computed tomography (1)
- Neugeborenenscreening (1)
- Neurometabolic disease (1)
- Neuropilin (1)
- Neuroprotective (1)
- Next Generation Sequencing (NGS) (1)
- Next generation sequencing (1)
- Next generation sequencing (NGS) (1)
- Nickel-based superalloy (1)
- Nickelbasis-Superlegierung (1)
- Nitriles (1)
- Nitrogruppe (1)
- Node involvement (1)
- Non-covalent interaction MS* (1)
- Non-destructive (1)
- Nonketotic hyperglycinemia (1)
- Nonlinear coefficient (1)
- O3/UV (1)
- OA, organic acids (1)
- OH-Zahl-Bestimmungen (1)
- OH-number (1)
- OXCT1 (1)
- Oak leaf poisoning (1)
- Off-target effects (1)
- Oligodendroglioma (1)
- Optical sensor (1)
- Optische Gassensorik (1)
- Orai1 (1)
- Organische Säuren (1)
- Organosolv (1)
- Organosolv process (1)
- Organosolv-Lignin (1)
- Organosolv-Verfahren (1)
- Orientation averaging (1)
- Orion (1)
- Osteogene Linie (1)
- Osteogenic differentiation (1)
- Osteogenic lineage (1)
- Ovarian cancer (1)
- Oxazolidinone antibiotics (1)
- P1 receptor (1)
- P2 receptor (1)
- P4 medicine (1)
- PCR inhibitors (1)
- PD-1/CTLA-4 (1)
- PDI (1)
- PEM electrolysis (1)
- PERK (1)
- PLASM (1)
- PLS-regression (1)
- PTHrP (1)
- PTR-MS (1)
- PTR-ToF (1)
- Packaging (1)
- Partial least squares regression (1)
- Partikeltechnologie (1)
- Partikelverarbeitung (1)
- Pathogenic Bacteria (1)
- Pattern recognition (1)
- Patterning (1)
- Paulownia (1)
- Paulownia tomemtosa (1)
- Peptidomimetic inhibitors (1)
- Permeation (1)
- Peroxisomes (1)
- Pervanadate (1)
- Pharmacogenetics (1)
- Phase II Reaktion (1)
- Phase II reaction (1)
- Phenol-Formaldehyd-Harze (1)
- Phenole-formaldehyde resin (1)
- Phenolic acids (1)
- Phenylacetyl-coenzym A (1)
- Phenyls (1)
- Photoinitiator (1)
- Photopolymerization (1)
- Phycocyanin lyase (1)
- Physical sensors (1)
- Physiological stress responses in plants (1)
- Picea abies (1)
- Picea pungens (1)
- Plasmid DNA (pBR322) (1)
- Pleiotropic drug resistance (1)
- Poly(acrylonitrile-co-1,3-butadiene-co-styrene)/polyamide 6 (ABS/PA 6) blends (1)
- Polymer Chemistry (1)
- Polymere (1)
- Polymers/copolymers (1)
- Polysaccharide derivatives (1)
- Polyurethan (1)
- Polyurethan-Coatings (1)
- Polyurethanbeschichtungen (1)
- Polyurethane (1)
- Portland cement (1)
- Post-prandial metabolism (1)
- Poultry (1)
- Poultry meat (1)
- Poultry spoilage (1)
- Pregnancy (1)
- Pressure-sensitive adhesive (1)
- Primary explosives (1)
- Principal component analysis (1)
- Probabilistic methods (1)
- Probenahme (1)
- Programmed cell death (1)
- Proliferation (1)
- Promoter methylation (1)
- Propellants (1)
- Prostate cancer (1)
- Proteasome (1)
- Proteasome maturation (1)
- Protected cultivation (1)
- Protein complex analysis (1)
- Protein-protein interaction (1)
- Proton-Transfer-Reaction Mass Spectrometry (1)
- Prunus avium L. (1)
- Präkeramische Papiere (1)
- Prüfungsvorbereitung (1)
- Ps. fluorescens (1)
- Pulping (1)
- Purinergic signaling (1)
- Py-GC/MS (1)
- Py-MS (1)
- Pyrogallol (1)
- Pyroglutamic aciduria (1)
- Pyrolyse-GC/MS (1)
- Pyrolysis GC/MS (1)
- Pyrolysis mass spectrometry (PyMS) (1)
- Pyrolysis-GC/FID (1)
- Pyrolysis-GC/MS (1)
- Pyrolysis-evolved gas analysis-mass spectrometry (1)
- Pyrolysis–GC/MS (1)
- Qualitative Analysis (1)
- Qualitative analysis (1)
- Quantification (1)
- Quasi equilibrium conditions (1)
- R751L (1)
- Radiation (1)
- Raman (1)
- Raman Spectroscopy (1)
- Raman and FTIR spectroscopies (1)
- Raman-Spektroskopie (1)
- Rapeseed pomace (1)
- Rapid method (1)
- Real-time measurement (1)
- Receptors, Purinergic P2 (1)
- Receptors, Purinergic/genetics/physiology (1)
- Redox potential (1)
- Regeneration (1)
- Research reproducibility and replicability (1)
- Resin based composite (1)
- Resin composite (1)
- Resin-based composites (1)
- Resource Planning (1)
- Ressource (1)
- Restorative composite (1)
- Reversible inhibition (1)
- RheoTack analysis (1)
- Rheologie (1)
- Rheology (1)
- Rheometer (1)
- Rosskastanie (1)
- Rubbers (1)
- S-sulfocysteine (1)
- SAM486A (1)
- SARS-COV-2 virus (1)
- SAXS (1)
- SCNN1D (1)
- SEC (1)
- SGN-35 (1)
- SHAP (1)
- SLC6 (1)
- SLC6A14 (1)
- SMBG (1)
- SNPSTR (1)
- SOS-LC (1)
- SOS-LUX test (1)
- SPME (1)
- STARLIFE project (1)
- STF-31 (1)
- Saccharomyces cerevisiae (1)
- Safety and security (1)
- Sample digestion (1)
- Saponin (1)
- Scanning electron microscopy (SEM) (1)
- Schadensanalyse (1)
- Schmauchspur (1)
- Schneeglöckchen (1)
- Schusswaffe (1)
- Schwindung (1)
- Sclera (1)
- Second-Year Undergraduate (1)
- Secondary compounds in plants (1)
- Secondary metabolism (1)
- Selektives Screening (1)
- Selenocysteine (1)
- Self-assembling (1)
- Sensorik (1)
- Sensors (1)
- Serine (1)
- Serine proteases (1)
- Sexual assault (1)
- Shear thickening (1)
- Shear viscosity (1)
- Sicherheitsmaßnahme (1)
- Silica gel (1)
- Silica-based nanobeads (1)
- Silicon Carbides (1)
- Silphium (1)
- Silphium perfoliatum (1)
- Simulated sunlight (1)
- Sinapine (1)
- Single Lens Reflex Camera (1)
- Single sperm cells (1)
- Skin (1)
- Skin cells (1)
- Skin flakes (1)
- Soluble CD21 (1)
- Soluble CD23 (1)
- Solution chemistry (1)
- Space (1)
- Space radiation (1)
- Spectroscropy (1)
- Sperm cells (1)
- Spermatozoa (1)
- Splicing (1)
- Spoilage (1)
- Spoilage bacteria (1)
- Sports doping (1)
- Sprengstoffspürhund (1)
- Sprouting (1)
- Spürhund (1)
- Stabilisator (1)
- Stabilization (1)
- Stabilizer (1)
- Stammzelle (1)
- Static stiffness (1)
- Statik (1)
- Statistical methods (1)
- Steinzeug (1)
- Stem cell (1)
- Stem cell differentiation (1)
- Stereoisomers (1)
- Steroidal saponin (1)
- Stiffness (1)
- Storage modulus (1)
- Store-operated calcium entry (1)
- Strain stiffening (1)
- Stress analysis (1)
- Stress strain relation (1)
- Strukturaufklärung (1)
- Studienfach (1)
- Study Island (1)
- Stöchiometrie (1)
- Substrate mapping (1)
- Substrate specificity (1)
- Sulfite oxidase (1)
- Sulfonamides (1)
- Superconductivity (1)
- Supervised classification (1)
- Support vector machines (1)
- Surfaces, interfaces and thin films (1)
- Surveillance (1)
- Survey (1)
- Suspension (1)
- Sympathetic reflexes (1)
- Synergie (1)
- Synovial fluid (1)
- Synthesis (1)
- Systemic lupus erythomatosus (SLE) (1)
- TATP (1)
- TGA-FTIR (1)
- TGA-MS (1)
- TOF (1)
- Tandem-Massenspektrometrie (1)
- Tap water (1)
- Targeted mass spectrometry (1)
- Technische Chemie (1)
- Telemedicine (1)
- Telogen hair (1)
- Temperaturgradienten (1)
- Template-mediation (1)
- Terbium(III) dipicolinic acid complex (1)
- Tetramerisation (1)
- Therapeutic antibodies* (1)
- Thermal barrier coating (1)
- Thermal conductivity (1)
- Thermal expansion (1)
- Thermochemical conversion (1)
- Thermodynamics (1)
- Thermoplastic polyurethanes (1)
- Thermormechanical fatigue/cycling (1)
- Thermoschockverhalten (1)
- Thiol antioxidants (1)
- TiO2-coatings (1)
- Time dependency (1)
- Time–kill methodology (1)
- Tinten (1)
- Tissue-specific promoters (1)
- Total phenol content (1)
- Transcription Regulation (1)
- Transcriptional targeting (1)
- Transdermal therapeutic system (1)
- Transformation products (1)
- Transgenic mice (1)
- Trapped radicals (1)
- Treatment (1)
- Truncated dhs (1)
- Type 2 diabetes (1)
- UPR signaling (1)
- UV Absorption (1)
- UV absorbance (1)
- UV spectrum (1)
- UV-Absorption (1)
- UV-VIS (1)
- UV-vis spectroscopy (1)
- Ultimate coefficient of thermal expansion (1)
- Ultrafine microstructures (1)
- Ultrasonic studies (1)
- Unconjugated THC-COOH (1)
- Urea cycle defect (1)
- Urinary bladder (1)
- Urinary organic acids (1)
- Urine organic acid analysis (1)
- Urothione (1)
- Used engine oil (1)
- VOCs (1)
- Valproic acid (1)
- Vascular Smooth Muscle Cells (1)
- Vascular cells (1)
- Vascular grafts (1)
- Vascular permeability (1)
- Vasculature (1)
- Verzug (1)
- Vibrational microspectroscopy (1)
- Vickers hardness (1)
- Vim3 (1)
- Visceral afferents (1)
- Visceral lipid tissue (1)
- Visceral pain (1)
- Viscoelastic behavior (1)
- Visible light curing (1)
- Visible light curing resin (1)
- Visible light-curing (1)
- Vitamin A acetate isomers (1)
- Volatile organic compounds (1)
- Vulkanisation (1)
- WAXS (1)
- WZB117 (1)
- Wasserverteilung (1)
- Weihnachtsbaum (1)
- Werkstoffmodellierung (1)
- Western blot (1)
- Whole genome amplification (WGA) (1)
- Whole-genome sequencing (1)
- Wild Type Mouse (1)
- Wildlife Forensics (1)
- Wireless sensor network (1)
- Wirkstofffreisetzung (1)
- Wnt/β-catenin (1)
- Wolframin (1)
- Wärmedämmschicht (1)
- X Thermal barrier coating (1)
- X-STR (1)
- X-ray photoelectron spectroscopy (1)
- X-ray powder diffraction (XRD) (1)
- XBP1 (1)
- XGBoost (1)
- XRD (1)
- Y-STR (1)
- Yeast (1)
- Yield stress (1)
- Young’s modulus (1)
- Zahnfollikel (1)
- Zahnfüllung (1)
- Zytokin-induzierte Killerzellen (1)
- accelerated iron ions (1)
- accurate monitoring (1)
- acetoacetic acid (1)
- acetone (1)
- acidic ethanosolv (1)
- actin (1)
- actinometry (1)
- adhesion factor (1)
- adoptive cell transfer (1)
- adverse effects (1)
- aerogels (1)
- agarose (1)
- aircraft engine part (1)
- albuminuria (1)
- alkaline phosphatase (1)
- alkyl amines (1)
- allergenicity (1)
- allosteric communication (1)
- altered mitochondrial homeostasis (1)
- amelogenesis (1)
- amino acid transporter (1)
- amodiaquine (1)
- amorphous 2D polymer (1)
- amplicon sequencing (1)
- anabolic (1)
- anaplastic lymphoma kinase (1)
- angiodiabetes (1)
- anorganische Schmauchspur (1)
- antibacterial (1)
- antibiotic prophylaxis (1)
- antibody–drug conjugate (1)
- antifungal (1)
- antimicrobial (1)
- antimicrobial coatings (1)
- antimikrobielle Beschichtungen (1)
- antioxidative capacity (1)
- antiradical activity (1)
- apple allergy (1)
- apple replant disease (ARD) (1)
- arthritis (1)
- ash (1)
- astrobiology (1)
- atmosphere (1)
- autism spectrum disorders (1)
- autohydrolysis (1)
- autoimmune disease (1)
- autologous bone graft (1)
- automated electrophysiology (1)
- automated sensor-screening (1)
- automatic measurement validation (1)
- automation of sample processing (1)
- automotive paint (1)
- automotive lever (1)
- autophagy signaling pathways (1)
- bagasse (1)
- basalt (1)
- bdelloid rotifer (1)
- beaching (1)
- behavior and cognition (1)
- benchtop (1)
- benzoyl-coA (1)
- beta-ketothiolase (1)
- bio-based (1)
- bio-chemicals (1)
- bio-innovation (1)
- bioactive factors (1)
- biobased plastics (1)
- biobasiert (1)
- biobasierte Kunststoffe (1)
- biochemical fingerprinting (1)
- biochemistry (1)
- biocomposite (1)
- biodegradable (1)
- bioenergy (1)
- biofilm removal (1)
- biofilm-related infections (1)
- bioinformatics (1)
- biomarker (1)
- biomarker profile (1)
- biomaterials (1)
- biomolecules (1)
- biopolymer (1)
- biopolymers (1)
- biorefineries (1)
- bio‐based (1)
- black fungi (1)
- blebbistatin (1)
- blood glucose meters (1)
- blood glucose monitoring device (1)
- blood vessel (1)
- blow molding (1)
- blown film (1)
- bone mineral density (1)
- bone remodeling (1)
- brain tumor (1)
- branched-chain amino acids (1)
- breast carcinoma (1)
- brightfield microscopy (1)
- brilliant green (1)
- built environment (1)
- bulk and local viscoelastic properties (1)
- bypass graft (1)
- cPMP (1)
- cabbage waste (1)
- calendering (1)
- cancer (1)
- cancer biomarker (1)
- cancer treatment (1)
- cannabidiol, immunotherapy (1)
- cardiodiabetes (1)
- cardiovascular replacement (1)
- cartilage (1)
- caspase (1)
- caspases (1)
- catabolic (1)
- catalysis (1)
- cell division (1)
- cell harvesting (1)
- cell viability (1)
- cellulose saccharification (1)
- cementogenesis (1)
- ceramic (1)
- ceramics (1)
- chaetocin (1)
- chain extender cross-linker (1)
- chain extenders cross-linker (1)
- chain extending cross-linker (1)
- chain-extending cross-linker (1)
- characterization (1)
- chemical pathology (1)
- chemosensing (1)
- chiral-nematic (1)
- chitosan (1)
- cholesteric liquid crystals (1)
- cholesteric phase (1)
- chromanones (1)
- chromatogram library (1)
- ciclopirox olamine (1)
- clear cell renal cell carcinoma (1)
- clear coat (1)
- clinical trials (1)
- coagulation (1)
- coaxial electrospinning (1)
- coefficient of thermal expansion (1)
- coffee ring effect (1)
- collagen (1)
- combination (1)
- combination of treatments (1)
- common variable immunodeficiency (1)
- components (1)
- composite materials (1)
- composites (1)
- compost disintegration (1)
- condensation (1)
- conditioned media (1)
- confocal fluorescence microscopy (1)
- contribution ratio (1)
- copolymers of methacrylic acid with poly(ethylene glycol) methyl ether methacrylate macromonomers (1)
- core-sheath fibers (1)
- cosmic rays (1)
- cost optimization (1)
- cracks (1)
- creep compliance (1)
- cross-linking (1)
- crystal violet (1)
- crystallinity (1)
- cube in cube model (1)
- curing behavior (1)
- cysticfibrosis (1)
- cytoskeleton (1)
- data base search (1)
- data evaluation (1)
- decay classes (1)
- defects (1)
- deformation behavior (1)
- degraded DNA (1)
- degree of disintegration (1)
- delta-subunit (1)
- demethylation (1)
- dental implant (1)
- dental polymers (1)
- dental stem cells (1)
- dental stem cells immortalization (1)
- dentinogenesis (1)
- dentogenesis (1)
- dependability analysis (1)
- depolymerization (1)
- desert cyanobacteria (1)
- designer drugs (1)
- detaching (1)
- determination of OH content (1)
- diabetes mellitus (1)
- diabetic dyslipidemia (1)
- diagnosis and management (1)
- dielectric analysis (DEA) (1)
- dielektrická analýza (1)
- differential scanning calorimetry (DSC) (1)
- disintegration kinetics (1)
- dissolved ozone (1)
- distribuce záření (1)
- distributed embedded computing system (1)
- draw ratio (1)
- drug delivery (1)
- drug detection (1)
- drug release materials (1)
- duty ratio (1)
- dyes (1)
- dynamic mechanic analysis (DMA) (1)
- eIF-5A (1)
- electroless copper deposition (1)
- electroretinography (1)
- electrospinning (1)
- elementary volume (1)
- encapsulation (1)
- endocytosis (1)
- endometrial carcinoma (1)
- endoplasmic reticulum (ER) stress (1)
- endoplasmic reticulum stress (1)
- endothelial cell (1)
- endothelial cell differentiation (1)
- endothelial cells (1)
- energy deposition (1)
- energy dispersive X-ray diffraction (1)
- engineering plastics (1)
- enzyme activity (1)
- epithelial sodium channel (1)
- epithelial transport (1)
- epitope mapping (1)
- ethacrynic acid (1)
- exon fusion (1)
- explosives (1)
- explosives detection (1)
- extra column band broadening (1)
- extraction-linked bias (1)
- failure analysis (1)
- fasentin (1)
- fatty acid metabolism (1)
- feature (1)
- fiber composites (1)
- fish gill (1)
- flow cytometry (1)
- flow direction (1)
- fluorinated salts (1)
- food contact material (1)
- food safety (1)
- force-retraction displacement-curve (1)
- forensic (1)
- forensic genetics (1)
- formulation (1)
- fotokompozit (1)
- fractional activity (1)
- fungal and bacterial amplicon sequencing (1)
- gas turbine blade (1)
- gene expression (1)
- generative manufacturing (1)
- genetic polymorphism (1)
- genomic data (1)
- genotype (1)
- geopolymer (1)
- geopolymer foam (1)
- glass fibers (1)
- glucocheck (1)
- glucose uptake inhibitor (1)
- glutamine N-phenylacetyltransferase (1)
- glycemic control (1)
- glycerol (1)
- greenhouse bio-test (1)
- growth factors (1)
- growth hormone (1)
- guidelines (1)
- habitability (1)
- halogen bonding (1)
- hard and soft tissue (1)
- hardness testing (1)
- harvest prediction (1)
- healthcare-associated infections (HAI) (1)
- heart protection (1)
- heat shock proteins (1)
- heat shock response (1)
- heat-transfer method (1)
- heavy ion particle (HZE) radations (1)
- helical drilling (1)
- helical twisting power (1)
- hepatocellular carcinoma (1)
- heterocyclic (1)
- heterozygous ALPL mutation (1)
- high diagnostic coverage and reliability (1)
- high dynamic range resistance readout (1)
- high-performance liquid chromatography (1)
- high-sensitivity C-reactive protein (hsCRP) (1)
- high-throughput DNA sequencing (1)
- high-throughput qRT-PCR (1)
- high-throughput sequencing (1)
- histamine receptor (1)
- histamine receptor antagonist (1)
- histidine decarboxylase (1)
- histone deacetylase inhibitors (1)
- homemade explosives (1)
- homeostatic model assessment (HOMA) (1)
- horse chestnut (1)
- hospital environment (1)
- hospital-acquired infections (1)
- human cholinesterases (1)
- human microbiome (1)
- hydrogen bonding (1)
- hydroxyapatite (1)
- hydroxypropylmethylcellulose (1)
- hyperammonemia (1)
- hypertension (1)
- hypogammaglobulinemia (1)
- hypoglycemia (1)
- hypophosphatasia (1)
- hypoxia (1)
- iPS cells (1)
- iPSCs (1)
- iPad (1)
- immune checkpoint inhibition programmed cell death-1 (1)
- immunhistochemistry (1)
- immunology (1)
- impact monitoring (1)
- impact sensitivity (1)
- impedance spectroscopy (1)
- impregnation-reduction (1)
- increments of retention indices (1)
- individualized therapy (1)
- infection prevention (1)
- infectious disease (1)
- infrared spectroscopy (1)
- inherited metabolic disease (1)
- inorganic pyrophosphate (1)
- intact proinsulin (1)
- integrative Simulation (1)
- integrative simulation (1)
- interferon γ (1)
- internal drug exposure (1)
- intrinsic pathway (1)
- invasion (1)
- ion viscosity (1)
- ionic polymer metal (1)
- isoleucine metabolism (1)
- isothermal (1)
- ketogenesis defects (1)
- ketogenez defektleri (1)
- ketoliz defektleri (1)
- ketolysis defects (1)
- keton bodies (1)
- ketone body synthesis (1)
- kinetika vytvrzování (1)
- klarzelliges Nierenzellkarzinom (1)
- layer-by-layer encapsulation (1)
- leishmaniasis (1)
- leucine degradation (1)
- life on Mars (1)
- life-detection (1)
- light distribution (1)
- lignin structure analysis (1)
- lignocellulose chemistry (1)
- lignocellulosic feedstock (1)
- lignocellulosic raw material (1)
- lignosulfonate (1)
- liquid chromatography (1)
- liquid crystal (1)
- liquid crystals (1)
- long interspersed nuclear element-1 (1)
- long-term storage (1)
- low detection limits (1)
- low molecular weight (1)
- low-level laser therapy (1)
- lung cancer (1)
- lymphoma (1)
- mTOR (1)
- major histocompatibility complex class I polypeptide-related sequence A (MICA) (1)
- massive parallel sequencing (1)
- material modelling (1)
- materials processing (1)
- maturity index (1)
- mechanical testing (1)
- mechanical thinning (1)
- melt fraction (1)
- melt interconnection (1)
- member D (NKG2D) (1)
- mesenchymal stem cell (1)
- mesogens (1)
- metabolic effects (1)
- metabolically active cells (1)
- metal nanoparticles (1)
- metal-oxide-semiconductor gas sensors (1)
- methylmalonic acidaemia (1)
- methylmalonic acidemia (1)
- miR-15 (1)
- miR-498 (1)
- micro processing (1)
- microbial community structure (1)
- microbial contamination (1)
- microbial ecology (1)
- microbiome (1)
- microbiome analyses (1)
- microdialysis (1)
- microindentation (1)
- micromanipulation (1)
- microplastic (1)
- microsatellite instability (1)
- mitochondrial biogenesis (1)
- mixed-mode chromatography (1)
- mobile Explosivstoffdetektion (1)
- modelling (1)
- mold temperature (1)
- molecular docking (1)
- molecular dynamics (1)
- molecular dynamics simulations (1)
- molecular mass degradation (1)
- molecular motor (1)
- molecular pathology (1)
- molecular weight (1)
- molecular weight determination (1)
- molecule-surface interactions (1)
- monoamine oxidases (1)
- monoclonal antibody (1)
- mouse model (1)
- multi-drug response (1)
- multiaxial stress state (1)
- multidimensional (1)
- multineurotarget agents (1)
- multiple myeloma (1)
- multiple myeloma (MM) (1)
- multiresolution analysis (1)
- multivariate data analysis (1)
- multivariate statistical analysis (1)
- multivariate statistics (1)
- mutations (1)
- myogenesis (1)
- nachhaltig (1)
- nano structured gas sensors (1)
- nanobodies (1)
- nanocrystalline diamond (1)
- nanomaterials (1)
- nanomedicine (1)
- nanostructured surfaces (1)
- natural fiber (1)
- natural killer group 2 (1)
- neoexpression (1)
- neuroendocrine (1)
- next generation sequencing (1)
- nitrogen dioxide (1)
- non-HDL-C and Cardiovascular disease (1)
- non-apoptotic roles (1)
- non-small cell lung cancer (1)
- non-woven fiber mats (1)
- nondestructive examination (1)
- nosocomial infections (1)
- nucleic acids (1)
- nutrient germinants (1)
- nutrigenetics (1)
- nutrigenomics (1)
- odontogenic cells (1)
- operando Raman spectroscopies (1)
- organic acid analysis (1)
- organische Schmauchspur (1)
- organoids (1)
- organosolv lignin (1)
- orthotropes prozessabhängiges Materialverhalten (1)
- orthotropic process-dependent material behavior (1)
- osteogenic potential (1)
- osteoporosis (1)
- outer space (1)
- oxalic acid (1)
- p27 (1)
- p53 (1)
- paediatric clinical genetics & dysmorphology (1)
- paediatric endocrinology (1)
- paediatric intensive & critical care (1)
- panspermia (1)
- papier-abgeleitete Keramiken (1)
- papierabgeleitete Keramik (1)
- partial melting (1)
- partial squares regression (1)
- particle processing (1)
- particulate composite (1)
- patent (1)
- pathogen control (1)
- pathogenic microorganisms (1)
- pathophysiology (1)
- peptide sequencing (1)
- perpendicular (1)
- personalized medicine (1)
- pharmacokinetics (1)
- phase II reaction (1)
- phenylacetyl-coA (1)
- phenylketonuria (1)
- phosphoethanolamine (1)
- photo-curing of polymers (1)
- photo-polymerization (1)
- photocatalysis (1)
- photostabiliser (1)
- phytoalexins (1)
- pigments (1)
- planetary protection (1)
- plastic pollution (1)
- poly(butylene adipate-co-terephthalate) (1)
- poly(ethylene glycol) methyl ether methacrylate macromonomers (1)
- polybutylene adipate terephthalate (1)
- polyelectrolytes (1)
- polylactic acid (1)
- polysaccharide (1)
- polytunnel (1)
- polyurethane coatings (1)
- porosity (1)
- porphyria (1)
- postmenopause (1)
- potentiometric sensors (1)
- power industry (1)
- power stroke (1)
- precision (1)
- pressure sensitive adhesive (1)
- primary airway epithelial cells (1)
- primates (1)
- primäre Explosivstoffe (1)
- principal component analysis (1)
- prioritizable ranking (1)
- proanthocyanidins (1)
- probiotic cleaning (1)
- probiotic-based cleaning formulations (1)
- process parameters (1)
- process-induced morphology (1)
- process-induced structure (1)
- processing-structure-property relationship (1)
- project-specific cost profile (1)
- proliferation (1)
- propionic acidaemia (1)
- propionic acidemia (1)
- protected cultivation (1)
- protein microarray (1)
- proteomics (1)
- prototype apparatus (1)
- proximal tubule (1)
- präkeramisches Papier (1)
- pseudogene (1)
- purinergic receptor (1)
- purinergic receptors (1)
- pyridoxal phosphate (1)
- pyrolysis-GC (1)
- pyrolysis-gas chromatography/mass-spectrometry (1)
- pyroplastic deformation (1)
- pyroplastic index (1)
- pyroplastische Verformung (1)
- pyroplastischer Index (1)
- qNMR (1)
- qPCR (1)
- quantitative RP-HPLC-DAD (1)
- quantitative RT-PCR (1)
- radiation (1)
- radioresistance (1)
- rating method (1)
- real-time PCR (1)
- recurrent ketoacidotic episodes (1)
- redundancy (1)
- regenerative medicine (1)
- relative density (1)
- release kinetics (1)
- renal cancer (1)
- renal cell carcinoma (1)
- renal tubular cells (1)
- resin for 3D-printing (1)
- resistance (1)
- ressources (1)
- restenosis (1)
- retinal degeneration (1)
- retraction speed dependency (1)
- rheumatoid arthritis (1)
- ring-size statistics (1)
- ripening (1)
- rodent (1)
- rodents (1)
- rosiglitazone (1)
- rubbers (1)
- sCD21 (1)
- safety measures (1)
- scanning tunnelling microscopy (1)
- scratch assay (1)
- screening (1)
- seed coat (1)
- selectivity tuning (1)
- self-assembled monolayers (1)
- self-monitoring BG (1)
- semiconducting metal oxide gas sensor array (1)
- semiconductors (1)
- sensitize (1)
- sensor array (1)
- sensory characterisation (1)
- sequencing (1)
- sexual assault (1)
- short tandem repeat (1)
- short tandem repeat (STR) (1)
- short-range correlation (1)
- shrinkage (1)
- single-domain antibody (1)
- single-nucleotide polymorphisms in DNA (1)
- sintering (1)
- sirtuins (1)
- size exclusion chromatography (1)
- skin cancer (1)
- slope based signature (1)
- smooth muscle cell (1)
- smooth muscle cell differentiation (1)
- snowdrop (1)
- sodium alginate (1)
- sodium self-inhibition (1)
- soil properties (1)
- soil sickness (1)
- sol-gel support (1)
- solute carrier (1)
- solvent exchange (1)
- space radiation environment (1)
- sperm cell (1)
- spore resistance (1)
- sporegermination (1)
- stabilisation (1)
- stabiliser (1)
- stationary phase (1)
- staurosporine (1)
- steady-state concentration (1)
- stem cell niche (1)
- stent (1)
- stoneware (1)
- stress analysis (1)
- structural biology (1)
- structural coloration (1)
- structure elucidation (1)
- structure prediction (1)
- substance aging (1)
- superalloys (1)
- supercritical drying (1)
- superficially porous particles (1)
- supramolecular liquid crystals (1)
- surface modification (1)
- surface sanitization (1)
- surfaces (1)
- surrogate endpoint (1)
- survival (1)
- sustainable (1)
- sweet cherry (Prunus avium L.) (1)
- sweet sorghum (1)
- switchgear station (1)
- synergism (1)
- synergistic effect (1)
- synthetic sapphire (1)
- system lay-out (1)
- system optimization (1)
- systemic response (1)
- tRNA processing (1)
- tack (1)
- temperature influence (1)
- templates (1)
- temporomandibular joint (1)
- therapy (1)
- thermal barrier coating (1)
- thermal gradient (1)
- thermal insulation material (1)
- thermal insulation materials (1)
- thermal shock behaviour (1)
- thermo-mechanical fatigue (1)
- thermochemical conversion (1)
- thermogravimetric analysis (1)
- thermomechanical fatigue/cycling (1)
- thermomechanische Ermüdung (1)
- thermophoresis (1)
- thermosensing (1)
- thin film (1)
- tiglyglycine (1)
- time series analysis (1)
- total phenolic content (1)
- transcriptional regulation (1)
- transient kinetics (1)
- transient receptor potential vanilloid Type 2 (1)
- triacetone triperoxide (1)
- triacetone triperoxides (1)
- triiodothyronine (1)
- triphenylmethane dyes (1)
- tumor diagnosis (1)
- tunable pitch (1)
- tunable sheet resistance (1)
- tungsten oxide (1)
- tungsten oxides (1)
- tvrdost (1)
- two-electrode voltage clamp (1)
- ultrashort pulse laser (1)
- unfolded protein response (1)
- unfolded protein response (UPR) (1)
- urea cycle defect (1)
- valine catabolic pathway (1)
- valine degradation (1)
- van Deemter curve (1)
- viscoelastic properties (1)
- visible light curing resin based composites (1)
- viskoelastické vlastnosti (1)
- volatile organic compound (VOC) sensing (1)
- volatile organic compounds (1)
- vytvrzování světlem (1)
- warpage (1)
- water-to-land transition (1)
- wearable technology (1)
- whole genome amplification (WGA) (1)
- whole-tooth regeneration (1)
- woody debris (1)
- wound healing assay (1)
- yield (1)
- yin-yang effect (1)
- zona pellucida protein 2 ZP2 (1)
- µCT (1)
- ß-OHB (1)
- ß-hydroxybutyrate (1)
- β-amino acids (1)
- β-catenin (1)
- β-catenin expression (1)
- β-cell dysfunction (1)
- β-cells (1)
- γ-glutamyl cycle (1)
- σ1 and σ2 receptors (1)
The Chemotype of Chromanones as a Privileged Scaffold for Multineurotarget Anti-Alzheimer Agents
(2022)
The cystic fibrosis transmembrane conductance regulator (CFTR) anion channel and the epithelial Na+ channel (ENaC) play essential roles in transepithelial ion and fluid transport in numerous epithelial tissues. Inhibitors of both channels have been important tools for defining their physiological role in vitro. However, two commonly used CFTR inhibitors, CFTRinh-172 and GlyH-101, also inhibit non-CFTR anion channels, indicating they are not CFTR specific. However, the potential off-target effects of these inhibitors on epithelial cation channels has to date not been addressed. Here, we show that both CFTR blockers, at concentrations routinely employed by many researchers, caused a significant inhibition of store-operated calcium entry (SOCE) that was time-dependent, poorly reversible and independent of CFTR. Patch clamp experiments showed that both CFTRinh-172 and GlyH-101 caused a significant block of Orai1-mediated whole cell currents, establishing that they likely reduce SOCE via modulation of this Ca2+ release-activated Ca2+ (CRAC) channel. In addition to off-target effects on calcium channels, both inhibitors significantly reduced human αβγ-ENaC-mediated currents after heterologous expression in Xenopus oocytes, but had differential effects on δβγ-ENaC function. Molecular docking identified two putative binding sites in the extracellular domain of ENaC for both CFTR blockers. Together, our results indicate that caution is needed when using these two CFTR inhibitors to dissect the role of CFTR, and potentially ENaC, in physiological processes.
SLC6A14 (ATB0,+) is unique among SLC proteins in its ability to transport 18 of the 20 proteinogenic (dipolar and cationic) amino acids and naturally occurring and synthetic analogues (including anti-viral prodrugs and nitric oxide synthase (NOS) inhibitors). SLC6A14 mediates amino acid uptake in multiple cell types where increased expression is associated with pathophysiological conditions including some cancers. Here, we investigated how a key position within the core LeuT-fold structure of SLC6A14 influences substrate specificity. Homology modelling and sequence analysis identified the transmembrane domain 3 residue V128 as equivalent to a position known to influence substrate specificity in distantly related SLC36 and SLC38 amino acid transporters. SLC6A14, with and without V128 mutations, was heterologously expressed and function determined by radiotracer solute uptake and electrophysiological measurement of transporter-associated current. Substituting the amino acid residue occupying the SLC6A14 128 position modified the binding pocket environment and selectively disrupted transport of cationic (but not dipolar) amino acids and related NOS inhibitors. By understanding the molecular basis of amino acid transporter substrate specificity we can improve knowledge of how this multi-functional transporter can be targeted and how the LeuT-fold facilitates such diversity in function among the SLC6 family and other SLC amino acid transporters.
The following work presents algorithms for semi-automatic validation, feature extraction and ranking of time series measurements acquired from MOX gas sensors. Semi-automatic measurement validation is accomplished by extending established curve similarity algorithms with a slope-based signature calculation. Furthermore, a feature-based ranking metric is introduced. It allows for individual prioritization of each feature and can be used to find the best performing sensors regarding multiple research questions. Finally, the functionality of the algorithms, as well as the developed software suite, are demonstrated with an exemplary scenario, illustrating how to find the most power-efficient MOX gas sensor in a data set collected during an extensive screening consisting of 16,320 measurements, all taken with different sensors at various temperatures and analytes.
A precise characterization of substances is essential for the safe handling of explosives. One parameter regularly characterized is the impact sensitivity. This is typically determined using a drop hammer. However, the results can vary depending on the test method and even the operator, and it is not possible to distinguish the type of decomposition such as detonation and deflagration. This study monitors the reaction progress by constructing a drop hammer to measure the decomposition reaction of four different primary explosives (tetrazene, silver azide, lead azide, lead styphnate) in order to determine the reproducibility of this method. Additionally, further possible evaluation methods are explored to improve on the current binary statistical analysis. To determine whether classification was possible based on extracted features, the responses of equipped sensor arrays, which measure and monitor the reactions, were studied and evaluated. Features were extracted from this data and were evaluated using multivariate methods such as principal component analysis (PCA) and linear discriminant analysis (LDA). The results indicate that although the measurements show substance specific trends, they also show a large scatter for each substance. By reducing the dimensions of the extracted features, different sample clusters can be represented and the calculated loadings allow significant parameters to be determined for classification. The results also suggest that differentiation of different reaction mechanisms is feasible. Testing of the regressor function shows reliable results considering the comparatively small amount of data.
Cytokine-induced killer cells (CIK) in combination with dendritic cells (DCs) have shown favorable outcomes in renal cell carcinoma (RCC), yet some patients exhibit recurrence or no response to this therapy. In a broader perspective, enhancing the antitumor response of DC-CIK cells may help to address this issue. Considering this, herein, we investigated the effect of anti-CD40 and anti-CTLA-4 antibodies on the antitumor response of DC-CIK cells against RCC cell lines. Our analysis showed that, a) anti-CD40 antibody (G28.5) increased the CD3+CD56+ effector cells of CIK cells by promoting the maturation and activation of DCs, b) G28.5 also increased CTLA-4 expression in CIK cells via DCs, but the increase could be hindered by the CTLA-4 inhibitor (ipilimumab), c) adding ipilimumab was also able to significantly increase the proportion of CD3+CD56+ cells in DC-CIK cells, d) anti-CD40 antibodies predominated over anti-CTLA-4 antibodies for cytotoxicity, apoptotic effect and IFN-g secretion of DC-CIK cells against RCC cells, e) after ipilimumab treatment, the population of Tregs in CIK cells remained unaffected, but ipilimumab combined with G28.5 significantly reduced the expression of CD28 in CIK cells. Taken together, we suggest that the agonistic anti-CD40 antibody rather than CTLA-4 inhibitor may improve the antitumor response of DC-CIK cells, particularly in RCC. In addition, we pointed towards the yet to be known contribution of CD28 in the crosstalk between anti-CTLA-4 and CIK cells.
While many proteins are known clients of heat shock protein 90 (Hsp90), it is unclear whether the transcription factor, thyroid hormone receptor beta (TRb), interacts with Hsp90 to control hormonal perception and signaling. Higher Hsp90 expression in mouse fibroblasts was elicited by the addition of triiodothyronine (T3). T3 bound to Hsp90 and enhanced adenosine triphosphate (ATP) binding of Hsp90 due to a specific binding site for T3, as identified by molecular docking experiments. The binding of TRb to Hsp90 was prevented by T3 or by the thyroid mimetic sobetirome. Purified recombinant TRb trapped Hsp90 from cell lysate or purified Hsp90 in pull-down experiments. The affinity of Hsp90 for TRb was 124 nM. Furthermore, T3 induced the release of bound TRb from Hsp90, which was shown by streptavidin-conjugated quantum dot (SAv-QD) masking assay. The data indicate that the T3 interaction with TRb and Hsp90 may be an amplifier of the cellular stress response by blocking Hsp90 activity.
Approximately 45% of global greenhouse gas emissions are caused by the construction and use of buildings. Thermal insulation of buildings in the current context of climate change is a well-known strategy to improve the energy efficiency of buildings. The development of renewable insulation material can overcome the drawbacks of widely used insulation systems based on polystyrene or mineral wool. This study analyzes the sustainability and thermal conductivity of new insulation materials made of Miscanthus x giganteus fibers, foaming agents, and alkali-activated fly ash binder. Life cycle assessments (LCA) are necessary to perform benchmarking of environmental impacts of new formulations of geopolymer-based insulation materials. The global warming potential (GWP) of the product is primarily determined by the main binder component sodium silicate. Sodium silicate's CO2 emissions depend on local production, transportation, and energy consumption. The results, which have been published during recent years, vary in a wide range from 0.3 kg to 3.3 kg CO2-eq. kg-1. The overall GWP of the insulation system based on Miscanthus fibers, with properties according to current thermal insulation regulations, reaches up to 95% savings of CO2 emissions compared to conventional systems. Carbon neutrality can be achieved through formulations containing raw materials with carbon dioxide emissions and renewable materials with negative GWP, thus balancing CO2 emissions.
Introduction of Matrix-Filler Adhesion to Modelling of Elastic Moduli of Particulate Composites
(2022)
Cube in cube elementary volume (EV) concept serves to predict a filler-content dependent Young´s moduli of particle filled composites using moduli of a matrix EM and a filler EF. Paul and Ishai-Cohen derived formulas for composites moduli considering different load transfer boundaries in the EV assuming a complete filler-matrix adhesion. In this paper it is confirmed that their models represent the upper and lower bounds, respectively, with the respect to the experimental data. However, in vast majority of composites a filler-matrix adhesion is not complete. Therefore, an adhesion factor kadh gaining values between 0 and 1 was introduced into Paul´s model to consider the reduced adhesion as the reduction of the filler-matrix contact area for glass beads filled in polar and unpolar thermoplastic matrices as well as elastomer. The evaluation of these composite systems provides reasonable adhesion coefficients of PA66 > PBT > PP > PE-LD >> BR. It was also found that stiffening only occurs if kadh exceeds the minimum value adhesion of root square of E(M) divided by E(F). The determined kadh correspond to scanning electron microscopy observations of the composites fracture surfaces. Additionally, finite element analysis of the cubic and hexagonal arrangements of the EV show that the stress distributions are different, but they affect the calculated moduli only for the filler volume contents exceeding 20 %. The introduction of the filler-matrix adhesion provides more reliable predictions of Young´s moduli of particulate composites.
Here we provide the electrophysiology data for the manuscript "Two functional epithelial sodium channel isoforms are present in rodents despite pronounced evolutionary pseudogenization and exon fusion", published in Molecular Biology and Evolution (2021): msab271 (doi: 10.1093/molbev/msab271). Data are reported as current values in Excel format, sorted according to the appearance in Figures and supplemented by explanatory text on the procedures/data presentation.
Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC50 of 50 μM. The binding motif can influence the activity of Hsp90 by hindering ATP accessibility or the release of ADP.