Refine
H-BRS Bibliography
- yes (138)
Departments, institutes and facilities
- Fachbereich Angewandte Naturwissenschaften (33)
- Fachbereich Wirtschaftswissenschaften (31)
- Fachbereich Ingenieurwissenschaften und Kommunikation (26)
- Fachbereich Informatik (22)
- Institut für Technik, Ressourcenschonung und Energieeffizienz (TREE) (22)
- Internationales Zentrum für Nachhaltige Entwicklung (IZNE) (16)
- Institut für Medienentwicklung und -analyse (IMEA) (10)
- Institut für funktionale Gen-Analytik (IFGA) (10)
- Fachbereich Sozialpolitik und Soziale Sicherung (9)
- Institut für Sicherheitsforschung (ISF) (7)
Document Type
- Article (88)
- Part of a Book (18)
- Conference Object (13)
- Bachelor Thesis (5)
- Report (4)
- Part of Periodical (3)
- Working Paper (3)
- Book review (2)
- Book (monograph, edited volume) (1)
- Master's Thesis (1)
Year of publication
- 2022 (138) (remove)
Has Fulltext
- yes (138) (remove)
Keywords
- Knowledge Graphs (3)
- Machine Learning (3)
- Well-being (3)
- relaxation (3)
- Agil (2)
- Agilität (2)
- Bioinformatics (2)
- IT-Controlling (2)
- IT-Projektmanagement (2)
- Kanban (2)
Seit Sokrates bildet die Frage „Was macht ein glückliches Leben aus?“ den Ausgangspunkt der Entwicklung einer Vielfalt von Wohlbefindenstheorien. Den Kern dieses Aufsatzes bildet die Erörterung der Fragen, inwieweit das Konzept der empirischen Lebenszufriedenheit und die dadurch gewonnenen Korrelate einen Beitrag zur Beantwortung dieser Frage leisten und ob diese Antworten eine Wohlbefindenstheorie begründen können, welche die philosophische Theorie mit empirischen Ergebnissen verknüpft.
Im Zentrum dieses Aufsatzes steht eine Diskussion der wichtigsten Wohlbefindenstheorien, ihrer Qualitäten, Gemeinsamkeiten und Unterschiede. Einen Schwerpunkt bildet die Theorie der subjektiven Lebenszufriedenheit. Ich diskutiere Stärken und Schwächen des Konzeptes und stelle die wichtigsten Ergebnisse der empirischen Lebenszufriedenheitsforschung in einem Überblick dar.
Im Ergebnis argumentiere ich, dass die Resultate der empirischen Forschung als Grundlage einer subjektiv-objektiven Wohlbefindenstheorie dienen können. Qualitativ hochwertige zwischenmenschliche Beziehungen, ein gesunder Lebensstil, eine ausgewogene Work-Life-Balance, der Einsatz für Andere, das Verfolgen von Lebenszielen und persönlichen Interessen bilden die Grundlage einer Wohlbefindenstheorie, die sich auf empirische Lebenszufriedenheitsforschung stützt.
Was ist ein Labor?
(2022)
Der technische Fortschritt im Bereich der Erhebung, Speicherung und Verarbeitung von Daten macht es erforderlich, neue Fragen zu sozialverträglichen Datenmärkten aufzuwerfen. So gibt es sowohl eine Tendenz zur vereinfachten Datenteilung als auch die Forderung, die informationelle Selbstbestimmung besser zu schützen. Innerhalb dieses Spannungsfeldes bewegt sich die Idee von Datentreuhändern. Ziel des Beitrags ist darzulegen, dass zwischen verschiedenen Formen der Datentreuhänderschaft unterschieden werden sollte, um der Komplexität des Themas gerecht zu werden. Insbesondere bedarf es neben der mehrseitigen Treuhänderschaft, mit dem Treuhänder als neutraler Instanz, auch der einseitigen Treuhänderschaft, bei dem der Treuhänder als Anwalt der Verbraucherinteressen fungiert. Aus dieser Perspektive wird das Modell der Datentreuhänderschaft als stellvertretende Deutung der Interessen individueller und kollektiver Identitäten systematisch entwickelt.
Vorwort
(2022)
Vorwort
(2022)
Personal-Information-Management-Systeme (PIMS) gelten als Chance, um die Datensouveränität der Verbraucher zu stärken. Datenschutzbezogene Fragen sind für Verbraucher immer dort relevant, wo sie Verträge und Nutzungsbedingungen mit Diensteanbietern eingehen. Vor diesem Hintergrund diskutiert dieser Beitrag die Potenziale von VRM-Systemen, die nicht nur das Datenmanagement, sondern das gesamte Vertragsmanagement von Verbrauchern unterstützen. Dabei gehen wir der Frage nach, ob diese besser geeignet sind, um Verbraucher zu souveränem Handeln zu befähigen.
Unlimited paid time off policies are currently fashionable and widely discussed by HR professionals around the globe. While on the one hand, paid time off is considered a key benefit by employees and unlimited paid time off policies (UPTO) are seen as a major perk which may help in recruiting and retaining talented employees, on the other hand, early adopters reported that employees took less time off than previously, presumably leading to higher burnout rates. In this conceptual review, we discuss the theoretical and empirical evidence regarding the potential effects of UPTO on leave utilization, well-being and performance outcomes. We start out by defining UPTO and placing it in a historical and international perspective. Next, we discuss the key role of leave utilization in translating UPTO into concrete actions. The core of our article constitutes the description of the effects of UPTO and the two pathways through which these effects are assumed to unfold: autonomy need satisfaction and detrimental social processes. We moreover discuss the boundary conditions which facilitate or inhibit the successful utilization of UPTO on individual, team, and organizational level. In reviewing the literature from different fields and integrating existing theories, we arrive at a conceptual model and five propositions, which can guide future research on UPTO. We conclude with a discussion of the theoretical and societal implications of UPTO.
Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC50 of 50 μM. The binding motif can influence the activity of Hsp90 by hindering ATP accessibility or the release of ADP.
It is challenging to provide users with a haptic weight sensation of virtual objects in VR since current consumer VR controllers and software-based approaches such as pseudo-haptics cannot render appropriate haptic stimuli. To overcome these limitations, we developed a haptic VR controller named Triggermuscle that adjusts its trigger resistance according to the weight of a virtual object. Therefore, users need to adapt their index finger force to grab objects of different virtual weights. Dynamic and continuous adjustment is enabled by a spring mechanism inside the casing of an HTC Vive controller. In two user studies, we explored the effect on weight perception and found large differences between participants for sensing change in trigger resistance and thus for discriminating virtual weights. The variations were easily distinguished and associated with weight by some participants while others did not notice them at all. We discuss possible limitations, confounding factors, how to overcome them in future research and the pros and cons of this novel technology.
Trojanized software packages used in software supply chain attacks constitute an emerging threat. Unfortunately, there is still a lack of scalable approaches that allow automated and timely detection of malicious software packages and thus most detections are based on manual labor and expertise. However, it has been observed that most attack campaigns comprise multiple packages that share the same or similar malicious code. We leverage that fact to automatically reproduce manually identified clusters of known malicious packages that have been used in real world attacks, thus, reducing the need for expert knowledge and manual inspection. Our approach, AST Clustering using MCL to mimic Expertise (ACME), yields promising results with a 𝐹1 score of 0.99. Signatures are automatically generated based on characteristic code fragments from clusters and are subsequently used to scan the whole npm registry for unreported malicious packages. We are able to identify and report six malicious packages that have been removed from npm consequentially. Therefore, our approach can support the detection by reducing manual labor and hence may be employed by maintainers of package repositories to detect possible software supply chain attacks through trojanized software packages.
Therapeutic Treatments for Osteoporosis-Which Combination of Pills Is the Best among the Bad?
(2022)
Osteoporosis is a chronical, systemic skeletal disorder characterized by an increase in bone resorption, which leads to reduced bone density. The reduction in bone mineral density and therefore low bone mass results in an increased risk of fractures. Osteoporosis is caused by an imbalance in the normally strictly regulated bone homeostasis. This imbalance is caused by overactive bone-resorbing osteoclasts, while bone-synthesizing osteoblasts do not compensate for this. In this review, the mechanism is presented, underlined by in vitro and animal models to investigate this imbalance as well as the current status of clinical trials. Furthermore, new therapeutic strategies for osteoporosis are presented, such as anabolic treatments and catabolic treatments and treatments using biomaterials and biomolecules. Another focus is on new combination therapies with multiple drugs which are currently considered more beneficial for the treatment of osteoporosis than monotherapies. Taken together, this review starts with an overview and ends with the newest approaches for osteoporosis therapies and a future perspective not presented so far.
The Poverty Reduction Effect of Social Protection: The Pros and Cons of a Multidisciplinary Approach
(2022)
There is a growing body of knowledge on the complex effects of social protection on poverty in Africa. This article explores the pros and cons of a multidisciplinary approach to studying social protection policies. Our research aimed at studying the interaction between cash transfers and social health protection policies in terms of their impact on inclusive growth in Ghana and Kenya. Also, it explored the policy reform context over time to unravel programme dynamics and outcomes. The analysis combined econometric and qualitative impact assessments with national- and local-level political economic analyses. In particular, dynamic effects and improved understanding of processes are well captured by this approach, thus, pushing the understanding of implementation challenges over and beyond a ‘technological fix,’ as has been argued before by Niño-Zarazúa et al. (World Dev 40:163–176, 2012), However, multidisciplinary research puts considerable demands on data and data handling. Finally, some poverty reduction effects play out over a longer time, requiring longitudinal consistent data that is still scarce.
Background: Since presenteeism is related to numerous negative health and work-related effects, measures are required to reduce it. There are initial indications that how an organization deals with health has a decisive influence on employees’ presenteeism behavior.
Aims: The concept of health-promoting collaboration was developed on the basis of these indications. As an extension of healthy leadership it includes not only the leader but also co-workers. In modern forms of collaboration, leaders cannot be assigned sole responsibility for employees’ health, since the leader is often hardly visible (digital leadership) or there is no longer a clear leader (shared leadership). The study examines the concept of health-promoting collaboration in relation to presenteeism. Relationships between health-promoting collaboration, well-being and work ability are also in focus, regarding presenteeism as a mediator.
Methods: The data comprise the findings of a quantitative survey of 308 employees at a German university of applied sciences. Correlation and mediator analyses were conducted.
Results: The results show a significant negative relationship between health-promoting collaboration and presenteeism. Significant positive relationships were found between health-promoting collaboration and both well-being and work ability. Presenteeism was identified as a mediator of these relationships.
Conclusion: The relevance of health-promoting collaboration in reducing presenteeism was demonstrated and various starting points for practice were proposed. Future studies should investigate further this newly developed concept in relation to presenteeism.
Die Digitalisierung und der Einsatz von Informations- und Kommunikationstechnologien (ICT) hat im Arbeits- und Privatleben neben einer höheren Produktivität auch zu neuen Formen von psychischem Stress geführt. Das Stresserleben, das mit dem Einsatz von ICT verbunden ist, wird in der Literatur auch als Technostress bezeichnet. Die Forschung zu diesem Thema zeigt, dass die Entstehung von Technostress von individuellen Faktoren abhängt. Die Persönlichkeit von ICT-Anwenderinnen und Anwendern bestimmt nicht nur das Auftreten von Technostress, sondern hat auch Einfluss auf dessen gesundheitliche und leistungsbezogene Folgen. In diesem Literaturreview wird der Forschungsstand zu der Rolle von Persönlichkeitsunterschieden bei der Entstehung von Technostress und dessen Folgen systematisch zusammengefasst. Die Auswertung der relevanten Forschungsartikel erfolgt hinsichtlich verwendeter Variablen, Stichproben und Studiendesigns, statistischer Methoden, Theorien und Frameworks. Abschließend werden der aktuelle Forschungsstand eingeordnet und Forschungslücken aufgezeigt.
This paper investigates the effect of voltage sensors on the measurement of transient voltages for power semiconductors in a Double Pulse Test (DPT) environment.We adapt previously published models that were developed for current sensors and apply them to voltage sensors to evaluate their suitability for DPT applications. Similarities and differences between transient current and voltage sensors are investigated and the resulting methodology is applied to commercially available and experimental voltage sensors. Finally, a selection aid for given measurement tasks is derived that focuses on the measurement of fast-switching power semiconductors.
Flüssigkeit, die in Werbespots symbolisch für Menstruationsblut steht, war jahrzehntelang blau, erst im September 2021 zeigte ein Hersteller erstmalig eine Flüssigkeit, welche realitätsnah in der Farbe Rot dargestellt wurde (1). Hygieneartikel, die Menstruierende zwingend benötigen, sind in Deutschland mit wenigen Ausnahmen auf öffentlichen Toiletten nicht verfügbar: Das Nicht-Sichtbarsein offenbarte auch im Jahr 2021 das Tabu um natürliche biologische Prozesse des weiblichen Körpers. Scham und Einschränkungen, die sich verhindern ließen, sind die Folge. Menstruierende werden in ihrem Wohlbefinden limitiert, und negative Erlebnisse führen dazu, dass Betroffene in der Ausübung von sozialen, schulischen und beruflichen Aktivitäten nicht nur durch die Menstruation selbst, sondern auch durch Normen und Erziehungsmuster beeinträchtigt sind, wie zahlreiche internationale Studien gezeigt haben (2). Für den deutschen Hochschulkontext fehlen solche Studien bislang.
In young adulthood, important foundations are laid for health later in life. Hence, more attention should be paid to the health measures concerning students. A research field that is relevant to health but hitherto somewhat neglected in the student context is the phenomenon of presenteeism. Presenteeism refers to working despite illness and is associated with negative health and work-related effects. The study attempts to bridge the research gap regarding students and examines the effects of and reasons for this behavior. The consequences of digital learning on presenteeism behavior are moreover considered. A student survey (N = 1036) and qualitative interviews (N = 11) were conducted. The results of the quantitative study show significant negative relationships between presenteeism and health status, well-being, and ability to study. An increased experience of stress and a low level of detachment as characteristics of digital learning also show significant relationships with presenteeism. The qualitative interviews highlighted the aspect of not wanting to miss anything as the most important reason for presenteeism. The results provide useful insights for developing countermeasures to be easily integrated into university life, such as establishing fixed learning partners or the use of additional digital learning material.
MOTIVATION
The majority of biomedical knowledge is stored in structured databases or as unstructured text in scientific publications. This vast amount of information has led to numerous machine learning-based biological applications using either text through natural language processing (NLP) or structured data through knowledge graph embedding models (KGEMs). However, representations based on a single modality are inherently limited.
RESULTS
To generate better representations of biological knowledge, we propose STonKGs, a Sophisticated Transformer trained on biomedical text and Knowledge Graphs (KGs). This multimodal Transformer uses combined input sequences of structured information from KGs and unstructured text data from biomedical literature to learn joint representations in a shared embedding space. First, we pre-trained STonKGs on a knowledge base assembled by the Integrated Network and Dynamical Reasoning Assembler (INDRA) consisting of millions of text-triple pairs extracted from biomedical literature by multiple NLP systems. Then, we benchmarked STonKGs against three baseline models trained on either one of the modalities (i.e., text or KG) across eight different classification tasks, each corresponding to a different biological application. Our results demonstrate that STonKGs outperforms both baselines, especially on the more challenging tasks with respect to the number of classes, improving upon the F1-score of the best baseline by up to 0.084 (i.e., from 0.881 to 0.965). Finally, our pre-trained model as well as the model architecture can be adapted to various other transfer learning applications.
AVAILABILITY
We make the source code and the Python package of STonKGs available at GitHub (https://github.com/stonkgs/stonkgs) and PyPI (https://pypi.org/project/stonkgs/). The pre-trained STonKGs models and the task-specific classification models are respectively available at https://huggingface.co/stonkgs/stonkgs-150k and https://zenodo.org/communities/stonkgs.
SUPPLEMENTARY INFORMATION
Supplementary data are available at Bioinformatics online.
The utilization of simulation procedures is gaining increasing attention in the product development of extrusion blow molded parts. However, some simulation steps, like the simulation of shrinkage and warpage, are still associated with uncertainties. The reason for this is on the one hand a lack of standardized interfaces for the transfer of simulation data between different simulation tools, and on the other hand the complex time-, temperature- and process-dependent material behavior of the used semi crystalline polymers. Using a new vendor neutral interface standard for the data transfer, the shrinkage analysis of a simple blow molded part is investigated and compared to experimental data. A linear viscoelastic material model in combination with an orthotropic process- and temperature-dependent thermal expansion coefficient is used for the shrinkage prediction. A good agreement is observed. Finally, critical parameters in the simulation models that strongly influence the shrinkage analysis are identified by a sensitivity study.
A precise characterization of substances is essential for the safe handling of explosives. One parameter regularly characterized is the impact sensitivity. This is typically determined using a drop hammer. However, the results can vary depending on the test method and even the operator, and it is not possible to distinguish the type of decomposition such as detonation and deflagration. This study monitors the reaction progress by constructing a drop hammer to measure the decomposition reaction of four different primary explosives (tetrazene, silver azide, lead azide, lead styphnate) in order to determine the reproducibility of this method. Additionally, further possible evaluation methods are explored to improve on the current binary statistical analysis. To determine whether classification was possible based on extracted features, the responses of equipped sensor arrays, which measure and monitor the reactions, were studied and evaluated. Features were extracted from this data and were evaluated using multivariate methods such as principal component analysis (PCA) and linear discriminant analysis (LDA). The results indicate that although the measurements show substance specific trends, they also show a large scatter for each substance. By reducing the dimensions of the extracted features, different sample clusters can be represented and the calculated loadings allow significant parameters to be determined for classification. The results also suggest that differentiation of different reaction mechanisms is feasible. Testing of the regressor function shows reliable results considering the comparatively small amount of data.
The non-scientific questioning of scientific research during the COVID-19 pandemic, the unwillingness of a president of the United States of America to accept the result of a democratically held election: just in recent times, there have been quite a few striking examples of long-held certainties appearing as nothing more than just illusions. This essay reflects on the severe consequences of the loss of such certainties in the spheres of democratic politics on the one hand and of science, especially for highly differentiated societies, on the other hand as well as on their interdependencies. Furthermore, the author tries to make the case that this disillusionment could prove to be a salutary shock – reminding us that we need to take a stand for the things we hold as certainties, oftentimes even as calming ones, if we want them to stay how we always thought they were.
Despite the increasing interest in single family offices (SFOs) as an investment owned by an entrepreneurial family, research on SFOs is still in its infancy. In particular, little is known about the capital structures of SFOs or the roots of SFO heterogeneity regarding financial decisions. By drawing on a hand-collected sample of 104 SFOs and private equity (PE) firms, we compare the financing choices of these two investor types in the context of direct entrepreneurial investments (DEIs). Our data thereby provide empirical evidence that SFOs are less likely to raise debt than PE firms, suggesting that SFOs follow pecking-order theory. Regarding the heterogeneity of the financial decisions of SFOs, our data indicate that the relationship between SFOs and debt financing is reinforced by the idiosyncrasies of entrepreneurial families, such as higher levels of owner management and a higher firm age. Surprisingly, our data do not support a moderating effect for the emphasis placed on socioemotional wealth (SEW).
Robust Identification and Segmentation of the Outer Skin Layers in Volumetric Fingerprint Data
(2022)
Despite the long history of fingerprint biometrics and its use to authenticate individuals, there are still some unsolved challenges with fingerprint acquisition and presentation attack detection (PAD). Currently available commercial fingerprint capture devices struggle with non-ideal skin conditions, including soft skin in infants. They are also susceptible to presentation attacks, which limits their applicability in unsupervised scenarios such as border control. Optical coherence tomography (OCT) could be a promising solution to these problems. In this work, we propose a digital signal processing chain for segmenting two complementary fingerprints from the same OCT fingertip scan: One fingerprint is captured as usual from the epidermis (“outer fingerprint”), whereas the other is taken from inside the skin, at the junction between the epidermis and the underlying dermis (“inner fingerprint”). The resulting 3D fingerprints are then converted to a conventional 2D grayscale representation from which minutiae points can be extracted using existing methods. Our approach is device-independent and has been proven to work with two different time domain OCT scanners. Using efficient GPGPU computing, it took less than a second to process an entire gigabyte of OCT data. To validate the results, we captured OCT fingerprints of 130 individual fingers and compared them with conventional 2D fingerprints of the same fingers. We found that both the outer and inner OCT fingerprints were backward compatible with conventional 2D fingerprints, with the inner fingerprint generally being less damaged and, therefore, more reliable.
Characterization methods of pressure sensitive adhesives (PSA) originate from technical bonding and do not cover relevant data for the development and quality assurance of medical applications, where PSA with flexible backing layers are adopted to human skin. In this study, a new method called RheoTack is developed to determine (mechanically and optically) an adhesion and detaching behavior of flexible and transparent PSA based patches. Transdermal therapeutic systems (TTS) consisting of silicone-based PSAs on a flexible and transparent backing layer were tested on a rotational rheometer with an 8 mm plate as a probe rod at retraction speeds of 0.01, 0.1, and 1 mm/s with respect to their adhesion and detaching behavior in terms of force-retraction displacement curves. The curves consist of a compression phase to affirm wetting; a tensile deformation phase intercepting stretching, cavity, and fibril formation; and a failure phase with detaching. Their analysis provides values for stiffness, force, and displacement of the beginning of fibril formation, force and displacement of the beginning of a failure due to fibril breakage and detaching, as well as corresponding activation energies. All these parameters exhibit the pronounced dependency on the retraction speed. The force-retraction displacement curves together with the simultaneous video recordings of the TTS deformation from three different angles (three cameras) provide deeper insight into the deformation processes and allow for interpreting the properties’ characteristics for PSA applications.
SLC6A14 (ATB0,+) is unique among SLC proteins in its ability to transport 18 of the 20 proteinogenic (dipolar and cationic) amino acids and naturally occurring and synthetic analogues (including anti-viral prodrugs and nitric oxide synthase (NOS) inhibitors). SLC6A14 mediates amino acid uptake in multiple cell types where increased expression is associated with pathophysiological conditions including some cancers. Here, we investigated how a key position within the core LeuT-fold structure of SLC6A14 influences substrate specificity. Homology modelling and sequence analysis identified the transmembrane domain 3 residue V128 as equivalent to a position known to influence substrate specificity in distantly related SLC36 and SLC38 amino acid transporters. SLC6A14, with and without V128 mutations, was heterologously expressed and function determined by radiotracer solute uptake and electrophysiological measurement of transporter-associated current. Substituting the amino acid residue occupying the SLC6A14 128 position modified the binding pocket environment and selectively disrupted transport of cationic (but not dipolar) amino acids and related NOS inhibitors. By understanding the molecular basis of amino acid transporter substrate specificity we can improve knowledge of how this multi-functional transporter can be targeted and how the LeuT-fold facilitates such diversity in function among the SLC6 family and other SLC amino acid transporters.
The cooperation between researchers and practitioners during the different stages of the research process is promoted as it can be of benefit to both society and research supporting processes of ‘transformation’. While acknowledging the important potential of research–practice–collaborations (RPCs), this paper reflects on RPCs from a political-economic perspective to also address potential unintended adverse effects on knowledge generation due to divergent interests, incomplete information or the unequal distribution of resources. Asymmetries between actors may induce distorted and biased knowledge and even help produce or exacerbate existing inequalities. Potential merits and limitations of RPCs, therefore, need to be gauged. Taking RPCs seriously requires paying attention to these possible tensions—both in general and with respect to international development research, in particular: On the one hand, there are attempts to contribute to societal change and ethical concerns of equity at the heart of international development research, and on the other hand, there is the relative risk of encountering asymmetries more likely.
In her recent article, Bender discusses several aspects of research–practice–collaborations (RPCs). In this commentary, we apply Bender's arguments to experiences in engineering research and development (R&D). We investigate the influence of interaction with practice partners on relevance, credibility, and legitimacy in the special engineering field of product development and analyze which methodological approaches are already being pursued for dealing with diverging interests and asymmetries and which steps will be necessary to include interests of civil society beyond traditional customer relations.
Research-Practice-Collaborations Addressing One Health and Urban Transformation. A Case Study
(2022)
One Health is an integrative approach at the interface of humans, animals and the environment, which can be implemented as Research-Practice-Collaboration (RPC) for its interdisciplinarity and intersectoral focus on the co-production of knowledge. To exemplify this, the present commentary shows the example of the Forschungskolleg “One Health and Urban Transformation” funded by the Ministry of Culture and Science of the State Government of Nord Rhine Westphalia in Germany. After analysis, the factors identified for a better implementation of RPC for One Health were the ones that allowed for constant communication and the reduction of power asymmetries between practitioners and academics in the co-production of knowledge. In this light, the training of a new generation of scientists at the boundaries of different disciplines that have mediation skills between academia and practice is an important contribution with great implications for societal change that can aid the further development of RPC.
Soil nutrient depletion threatens global food security and has been seriously underestimated for potassium (K) and several micronutrients. This is particularly the case for highly weathered soils in tropical countries, where classical soluble fertilizers are often not affordable or not accessible. One way to replenish macro- and micronutrients are ground silicate rock powders (SRPs). Rock forming silicate minerals contain most nutrients essential for higher plants, yet slow and inconsistent weathering rates have restricted their use in the past. Recent findings, however, challenge past agronomic objections which insufficiently addressed the factorial complexity of the weathering process. This review therefore first presents a framework with the most relevant factors for the weathering of SRPs through which several outcomes of prior studies can be explained. A subsequent analysis of 48 crop trials reveals the potential as alternative K source and multi-nutrient soil amendment for tropical soils, whereas the benefits for temperate soils are currently inconclusive. Beneficial results prevail for mafic and ultramafic rocks like basalts and rocks containing nepheline or glauconite. Several rock modifications are highly efficient in increasing the agronomic effectiveness of SRPs. Enhanced weathering of SRPs could additionally sequester substantial amounts of CO2 from the atmosphere and silicon (Si) supply can induce a broad spectrum of plant biotic and abiotic stress resistance. Recycling massive amounts of rock residues from domestic mining industries could furthermore resolve serious disposal challenges and improve fertilizer self-sufficiency. In conclusion, under the right circumstances, SRPs could not only advance low-cost and regional soil sustaining crop production but contribute to various sustainable development goals.
Recovery Across Different Temporal Settings: How Lunchtime Activities Influence Evening Activities
(2022)
Recovery from work stress during workday breaks, free evenings, weekends, and vacations is known to benefit employee health and well-being. However, how recovery at different temporal settings is interconnected is not well understood. We hypothesized that on days when employees engage in recovery-enhancing lunchtime activities, they will experience higher resources when leaving home from work (i.e., low fatigue and high positive affect) and consequently spend more time on recovery-enhancing activities in the evening, thus creating a positive recovery cycle. In this study, 97 employees were randomized into lunchtime park walk and relaxation groups. As evening activities, we measured time spent on physical exercise, physical activity in natural surroundings, and social activities. Afternoon resources and time spent on evening activities were assessed twice a week before, during, and after the intervention, for five weeks. Our results based on multilevel analyses showed that on days when employees completed the lunchtime park walk, they spent more time on evening physical exercise and physical activity in natural surroundings compared to days when the lunch break was spent as usual. However, neither lunchtime relaxation exercises nor afternoon resources were associated with any of the evening activities. Our findings suggest that other factors than afternoon resources are more important in determining how much time employees spend on various evening activities. Fifteen-minute lunchtime park walks inspired employees to engage in similar healthbenefitting activities during their free time.
Qualität der Qualitätsprüfung: Testberichte im klassischen und modernen Videospieljournalismus
(2022)
Die Hochzeit des gedruckten Videospieljournalismus um die Jahrtausendwende ist vorüber. Seit über 15 Jahren sind die verkauften Auflagen der klassischen Videospielzeitschriften wie Gamestar oder PC Games rückläufig. Andere Magazine wurden zwischenzeitlich aus wirtschaftlichen Gründen eingestellt, darunter PC Action oder auch der einstige Marktführer Computer Bild Spiele. Trotzdem entwickelte sich eine journalistische Gegenbewegung, die Kieron Gillen im Jahr 2004 in seinem Manifest "The New Games Journalism" begründete. Es entstanden in Deutschland Videospielzeitschriften wie GAIN oder WASD, deren Berichterstattung Videospiele weniger als Produkt, sondern zunehmend als künstlerisches Objekt wahrnehmen und sie in einen gesellschaftlichen und kulturellen Kontext einordnen.
Ungeachtet dessen erfolgt in den Redaktionen eine technische und inhaltliche Sichtung der Videospiele, die dem Publikum als Testbericht präsentiert wird. Da es sich dabei aus historischer Perspektive um den Kerninhalt von Videospielzeitschriften handelt, soll dieser als Analysegegenstand dieser Arbeit dienen und ein Indiz für die Qualität der Magazine als Ganzes sein. Mit Blick auf die unterschiedlichen Entwicklungen im Videospieljournalismus soll folgende Frage beantwortet werden: Verfügen moderne Videospielzeitschriften über eine höhere Qualität als klassische Magazine? Dazu erfolgt eine qualitative Inhaltsanalyse der Testberichte und ein Vergleich mit etablierten Qualitätsmerkmalen aus dem allgemeinen Journalismus, ebenso wie dem Fach-, Nutzwert- und Videospieljournalismus.
ProtSTonKGs: A Sophisticated Transformer Trained on Protein Sequences, Text, and Knowledge Graphs
(2022)
While most approaches individually exploit unstructured data from the biomedical literature or structured data from biomedical knowledge graphs, their union can better exploit the advantages of such approaches, ultimately improving representations of biology. Using multimodal transformers for such purposes can improve performance on context dependent classication tasks, as demonstrated by our previous model, the Sophisticated Transformer Trained on Biomedical Text and Knowledge Graphs (STonKGs). In this work, we introduce ProtSTonKGs, a transformer aimed at learning all-encompassing representations of protein-protein interactions. ProtSTonKGs presents an extension to our previous work by adding textual protein descriptions and amino acid sequences (i.e., structural information) to the text- and knowledge graph-based input sequence used in STonKGs. We benchmark ProtSTonKGs against STonKGs, resulting in improved F1 scores by up to 0.066 (i.e., from 0.204 to 0.270) in several tasks such as predicting protein interactions in several contexts. Our work demonstrates how multimodal transformers can be used to integrate heterogeneous sources of information, paving the foundation for future approaches that use multiple modalities for biomedical applications.
The epithelial sodium channel (ENaC) is a heterotrimeric ion channel that plays a key role in sodium and water homeostasis in tetrapod vertebrates. In the aldosterone-sensitive distal nephron, hormonally controlled ENaC expression matches dietary sodium intake to its excretion. Furthermore, ENaC mediates sodium absorption across the epithelia of the colon, sweat ducts, reproductive tract, and lung. ENaC is a constitutively active ion channel and its expression, membrane abundance, and open probability (PO) are controlled by multiple intracellular and extracellular mediators and mechanisms [9]. Aberrant ENaC regulation is associated with severe human diseases, including hypertension, cystic fibrosis, pulmonary edema, pseudohypoaldosteronism type 1, and nephrotic syndrome [9].
Silicon carbide and graphene possess extraordinary chemical and physical properties. Here, these different systems are linked and the changes in structural and dynamic properties are investigated. For the simulations performed a classical molecular dynamic (MD) approach was used. In this approach, a graphene layer (N = 240 atoms) was grafted at different distances on top of a 6H-SiC structure (N = 2400 atoms) and onto a 3C-SiC structure (N = 1728 atoms). The distances between the graphene and the 6H are 1.0, 1.3 and 1.5 Å and the distances between the graphene layer and the 3C-SiC are 2.0, 2.3, and 2.5 Å. Each system has been equilibrated at room temperature until no further relaxation was observed. The 6H-SiC structure in combination with graphene proves to be more stable compared to the combination with 3C-SiC. This can be seen well in the determined energies. Pair distribution functions were influenced slightly by the graphene layer due to steric and energetic changes. This becomes clear from the small shifts of the C-C distances. Interactions as well as bonds between graphene and SiC lead to the fact that small shoulders of the high-frequency SiC-peaks are visible in the spectra and at the same time the high-frequency peaks of graphene are completely absent.
Process-induced changes in the morphology of biodegradable polybutylene adipate terephthalate (PBAT) and polylactic acid (PLA) blends modified with various multifunctional chainextending cross-linkers (CECLs) are presented. The morphology of unmodified and modified films produced with blown film extrusion is examined in an extrusion direction (ED) and a transverse direction (TD). While FTIR analysis showed only small peak shifts indicating that the CECLs modify the molecular weight of the PBAT/PLA blend, SEM investigations of the fracture surfaces of blown extrusion films revealed their significant effect on the morphology formed during the processing. Due to the combined shear and elongation deformation during blown film extrusion, rather spherical PLA islands were partly transformed into long fibrils, which tended to decay to chains of elliptical islands if cooled slowly. The CECL introduction into the blend changed the thickness of the PLA fibrils, modified the interface adhesion, and altered the deformation behavior of the PBAT matrix from brittle to ductile. The results proved that CECLs react selectively with PBAT, PLA, and their interface. Furthermore, the reactions of CECLs with PBAT/PLA induced by the processing depended on the deformation directions (ED and TD), thus resulting in further non-uniformities of blown extrusion films.
Modern GPUs come with dedicated hardware to perform ray/triangle intersections and bounding volume hierarchy (BVH) traversal. While the primary use case for this hardware is photorealistic 3D computer graphics, with careful algorithm design scientists can also use this special-purpose hardware to accelerate general-purpose computations such as point containment queries. This article explains the principles behind these techniques and their application to vector field visualization of large simulation data using particle tracing.
Aufgrund SARS-CoV-2 ist eine Rechtsvorlesung für Betriebswirte im Bachelorstudiengang an zwei verschiedenen Standorten der Hochschule Bonn-Rhein-Sieg mit über 300 Studierenden unter Anwendung des Inverted Classroom Ansatzes zum Sommersemester 2020 vollständig digitalisiert worden. Durch die von außen vorgegebene Lernstrategie mit wöchentlichen Arbeitspaketen und die Nutzung einer asynchronen Kommunikationsplattform auf Basis eines Instant Messengers mit adressatenadäquater Ansprache gelang es, Synchronformate auf ein notwendiges Minimum zu reduzieren. Die Ergebnisse der empirischen Begleitung zeigen, dass das neue didaktische Konzept für eine digitale Lehre die unterschiedlichsten Bedürfnisse der Studierenden befriedigte. Insbesondere konnte eine »digitale Lernatmosphäre« geschaffen werden, die von den Studierenden als sehr förderlich für ihren Lernprozess erachtet wurde. Die induzierte Lernstrategie führte zu signifikanten Leistungsverbesserungen. Es wird diskutiert, welche Maßnahmen sich auch für postpandemische Lehre empfehlen.
Dass die weitgehende kommerzielle Datenausspähung der großen Internetunternehmen nicht allein ein Problem der davon betroffenen Bürgerinnen und Bürger ist, sondern letztlich auch weitreichende gesellschaftliche Folgen hat, wurde mit dem Aufkommen des Rechtspopulismus in den USA, Brasilien und Europa zum Thema mindestens der Diskussion in Fachkreisen. Hass und Hetze im Netz, Fake News, politische Wahlwerbung und Manipulation in Social Media sind als Bedrohung für die freiheitlichen Demokratien westlicher Ausprägung unübersehbar geworden.
Operating an ozone-evolving PEM electrolyser in tap water: A case study of water and ion transport
(2022)
While PEM water electrolysis could be a favourable technique for in situ sanitization with ozone, its application is mainly limited to the use of ultrapure water to achieve a sufficient long-time stability. As additional charge carriers influence the occurring transport phenomena, we investigated the impact of different feed water qualities on the performance of a PEM tap water electrolyser for ozone evolution. The permeation of water and the four most abundant cations (Na+, K+, Ca2+, Mg2+) is characterised during stand-by and powered operation at different charge densities to quantify underlying transport mechanisms. Water transport is shown to linearly increase with the applied current (95 ± 2 mmol A−1 h−1) and occurs decoupled from ion permeation. A limitation of ion permeation is given by the transfer of ions in water to the anode/PEM interface. The unstabilized operation of a PEM electrolyser in tap water leads to a pH gradient which promotes the formation of magnesium and calcium carbonates and hydroxides on the cathode surface. The introduction of a novel auxiliary cathode in the anolytic compartment has shown to suppress ion permeation by close to 20%.
Purpose: Both Hungary and Germany belong to the old-world wine-producing countries and have long winemaking traditions. This paper aims at exploring and comparing online branding strategies of family SME (small and medium sized enterprises) wineries at Lake Balaton (Hungary) and Lake Constance (Germany), as two wine regions with similar geographic characteristics.
Design/methodology/approach: This paper, based on a total sample of 37 family wineries, 15 at Lake Balaton and 22 at Lake Constance, investigates the differences in brand identity on the website, brand image in social media and online communication channels deployed in both wine regions. The study applies a qualitative methodology using MaxQDA software for conducting content analysis of texts in websites and social media. Descriptive statistics and t-test were conducted to compare the usage of different communication channels and determine statistical significance.
Findings: At Lake Balaton, the vineyard, the winery and the family, while at Lake Constance, the lake itself and the grape are highlighted regarding family winery brand identity. The customer-based brand image of Hungarian family wineries emphasizes wine, food and service, with the predominant use of Facebook. In the German family wineries, the focus of brand identity is on wine, friendliness and taste and includes more extensive usage of websites.
Originality/value: The paper deploys a novel methodology, both in terms of tools used as well as geographic focus to uncover online branding patterns of family wineries, thereby providing implications for wine and tourism industries at lake regions. It compares the share of selected most-used words in the overall text in websites and in social media, and presents the key findings from this innovative approach.
Modern PCR-based analytical techniques have reached sensitivity levels that allow for obtaining complete forensic DNA profiles from even tiny traces containing genomic DNA amounts as small as 125 pg. Yet these techniques have reached their limits when it comes to the analysis of traces such as fingerprints or single cells. One suggestion to overcome these limits has been the usage of whole genome amplification (WGA) methods. These methods aim at increasing the copy number of genomic DNA and by this means generate more template DNA for subsequent analyses. Their application in forensic contexts has so far remained mostly an academic exercise, and results have not shown significant improvements and even have raised additional analytical problems. Until very recently, based on these disappointments, the forensic application of WGA seems to have largely been abandoned. In the meantime, however, novel improved methods are pointing towards a perspective for WGA in specific forensic applications. This review article tries to summarize current knowledge about WGA in forensics and suggests the forensic analysis of single-donor bioparticles and of single cells as promising applications.
Shaping off-job life is becoming increasingly important for workers to increase and maintain their optimal functioning (i.e., feeling and performing well). Proactively shaping the job domain (referred to as job crafting) has been extensively studied, but crafting in the off-job domain has received markedly less research attention. Based on the Integrative Needs Model of Crafting, needs-based off-job crafting is defined as workers’ proactive and self-initiated changes in their off-job lives, which target psychological needs satisfaction. Off-job crafting is posited as a possible means for workers to fulfill their needs and enhance well-being and performance over time. We developed a new scale to measure off-job crafting and examined its relationships to optimal functioning in different work contexts in different regions around the world (the United States, Germany, Austria, Switzerland, Finland, Japan, and the United Kingdom). Furthermore, we examined the criterion, convergent, incremental, discriminant, and structural validity evidence of the Needs-based Off-job Crafting Scale using multiple methods (longitudinal and cross-sectional survey studies, an “example generation”-task). The results showed that off-job crafting was related to optimal functioning over time, especially in the off-job domain but also in the job domain. Moreover, the novel off-job crafting scale had good convergent and discriminant validity, internal consistency, and test–retest reliability. To conclude, our series of studies in various countries show that off-job crafting can enhance optimal functioning in different life domains and support people in performing their duties sustainably. Therefore, shaping off-job life may be beneficial in an intensified and continually changing and challenging working life.
Nanomedicine strategies were first adapted and successfully translated to clinical application for diseases, such as cancer and diabetes. These strategies would no doubt benefit unmet diseases needs as in the case of leishmaniasis. The latter causes skin sores in the cutaneous form and affects internal organs in the visceral form. Treatment of cutaneous leishmaniasis (CL) aims at accelerating wound healing, reducing scarring and cosmetic morbidity, preventing parasite transmission and relapse. Unfortunately, available treatments show only suboptimal effectiveness and none of them were designed specifically for this disease condition. Tissue regeneration using nano-based devices coupled with drug delivery are currently being used in clinic to address diabetic wounds. Thus, in this review, we analyse the current treatment options and attempt to critically analyse the use of nanomedicine-based strategies to address CL wounds in view of achieving scarless wound healing, targeting secondary bacterial infection and lowering drug toxicity.
Der vorliegende Beitrag setzt sich mit der Bedeutung von Lernorten der beruflichen Bildung im Zuge einer BBNE sowie der diesbezüglichen Kompetenzentwicklung auseinander. Dabei wird entlang des BIBB-Modellversuchs „NAUZUBI“ ein möglicher Ansatz skizziert, der darauf ausgerichtet ist, eine integrative Kompetenzentwicklung in Nachhaltigkeitsthemen zu ermöglichen. Ausgangspunkt sind dabei betriebliche Nachhaltigkeitsaudits, die im vorliegenden Ansatz als kontextualisierte Zugänge für berufliche Lernanlässe dienten. Diese wurden in aufeinander abgestimmten Schritten im betrieblichen und schulischen Lernen reflektiert. Im Beitrag werden das Grundkonzept sowie die entsprechenden Umsetzungserfahrungen beschrieben. Es werden ferner Herausforderungen und Potenziale für das betriebliche, berufsschulische und das lernortkooperative Lernen und damit die integrative Kompetenzentwicklung dargestellt.
Recent advances in Natural Language Processing have substantially improved contextualized representations of language. However, the inclusion of factual knowledge, particularly in the biomedical domain, remains challenging. Hence, many Language Models (LMs) are extended by Knowledge Graphs (KGs), but most approaches require entity linking (i.e., explicit alignment between text and KG entities). Inspired by single-stream multimodal Transformers operating on text, image and video data, this thesis proposes the Sophisticated Transformer trained on biomedical text and Knowledge Graphs (STonKGs). STonKGs incorporates a novel multimodal architecture based on a cross encoder that uses the attention mechanism on a concatenation of input sequences derived from text and KG triples, respectively. Over 13 million so-called text-triple pairs, coming from PubMed and assembled using the Integrated Network and Dynamical Reasoning Assembler (INDRA), were used in an unsupervised pre-training procedure to learn representations of biomedical knowledge in STonKGs. By comparing STonKGs to an NLP- and a KG-baseline (operating on either text or KG data) on a benchmark consisting of eight fine-tuning tasks, the proposed knowledge integration method applied in STonKGs was empirically validated. Specifically, on tasks with a comparatively small dataset size and a larger number of classes, STonKGs resulted in considerable performance gains, beating the F1-score of the best baseline by up to 0.083. Both the source code as well as the code used to implement STonKGs are made publicly available so that the proposed method of this thesis can be extended to many other biomedical applications.
Guzzo et al. (Reference Guzzo, Schneider and Nalbantian2022) argue that open science practices may marginalize inductive and abductive research and preclude leveraging big data for scientific research. We share their assessment that the hypothetico-deductive paradigm has limitations (see also Staw, Reference Staw2016) and that big data provide grand opportunities (see also Oswald et al., Reference Oswald, Behrend, Putka and Sinar2020). However, we arrive at very different conclusions. Rather than opposing open science practices that build on a hypothetico-deductive paradigm, we should take initiative to do open science in a way compatible with the very nature of our discipline, namely by incorporating ambiguity and inductive decision-making. In this commentary, we (a) argue that inductive elements are necessary for research in naturalistic field settings across different stages of the research process, (b) discuss some misconceptions of open science practices that hide or discourage inductive elements, and (c) propose that field researchers can take ownership of open science in a way that embraces ambiguity and induction. We use an example research study to illustrate our points.