Refine
Departments, institutes and facilities
- Institut für funktionale Gen-Analytik (IFGA) (493) (remove)
Document Type
- Article (493) (remove)
Year of publication
Keywords
- ENaC (13)
- cytokine-induced killer cells (9)
- apoptosis (7)
- immunotherapy (7)
- DNA methylation (5)
- CD21 (4)
- Inborn error of metabolism (4)
- Organic aciduria (4)
- 5-Methylcytosine (3)
- Amiloride (3)
- Arthritis (3)
- Bcl-2 (3)
- DNA damage (3)
- DNA typing (3)
- K/BxN (3)
- Ketolysis (3)
- Metabolic acidosis (3)
- Na+/K+-ATPase (3)
- cancer (3)
- cytokine-induced killer (CIK) cells (3)
- delta-subunit (3)
- evolution (3)
- extremophiles (3)
- shedding (3)
- 3-hydroxyisobutyrate dehydrogenase (2)
- 3-hydroxyisobutyric aciduria (2)
- B cell activation (2)
- CIK cells (2)
- Canavan disease (2)
- Capillary electrophoresis – laser-induced fluorescence (2)
- Chronic lymphocytic leukemia (2)
- Complement receptor (2)
- Complement receptor 2/CD21 (2)
- DNA (2)
- DNA adducts (2)
- Enzyme activity (2)
- Epithelial Na+ channel (2)
- Epithelial sodium channel (2)
- Fatty acid metabolism (2)
- GLYCTK (2)
- Glycine conjugation (2)
- H2S (2)
- HIBADH (2)
- HIBADH deficiency (2)
- Hyperammonemia (2)
- Isovaleric acidemia (2)
- Ketoacidosis (2)
- Ketogenesis (2)
- Ketone body (2)
- Ketone body utilization (2)
- Mars (2)
- Mass spectrometry (2)
- Mast cells (2)
- Membrane Transport (2)
- Metabolicdecompensation (2)
- Movement disorder (2)
- NF-κB (2)
- Rheumatoid arthritis (2)
- SLC (2)
- Shedding (2)
- Short tandem repeat (STR) (2)
- Whole genome amplification (2)
- acetylcholine (2)
- autophagy (2)
- cell death (2)
- cystic fibrosis (2)
- d-Glycerate kinase deficiency (2)
- d-Glyceric aciduria (2)
- endocytosis (2)
- epithelial sodium channel (ENaC) (2)
- extraterrestrial analogue (2)
- extremophile (2)
- force generation (2)
- fungi (2)
- gasotransmitter (2)
- hydrogen sulfide (2)
- ketogenesis (2)
- ketolysis (2)
- life detection (2)
- lymphoma (2)
- melanin (2)
- mucociliary clearance (2)
- myosin (2)
- organic aciduria (2)
- sodium channel (2)
- sodium self-inhibition (2)
- sodium transport (2)
- transgenic mice (2)
- water-to-land transition (2)
- 16S rRNA gene sequencing (1)
- 2B4 (1)
- 3-hydroxy-n-butyric acid (1)
- 3-hydroxyisobutyrate dehydrogenase deficiency (1)
- 3-hydroxyisobutyric acid dehydrogenase deficiency (1)
- 5-HT (1)
- 5-Oxoprolinase (1)
- 5-oxoprolinuria (1)
- ACAT1 (1)
- ACacylcarnitines (1)
- ADA2 (1)
- ADP release (1)
- AMAtypical myopathy (1)
- AMT (1)
- APC superfamily (1)
- AR (1)
- ASIC (1)
- ASPA (1)
- ATB0,+ (1)
- ATPase cycle (1)
- Acute lymphoblastic leukemia (1)
- Acylpeptide hydrolase (1)
- Affinity proteomics (1)
- Airway surface liquid (1)
- Algorithms (1)
- Alkane (1)
- Allicin (1)
- Amino Acid Sequence (1)
- Aminoacylase (1)
- Aminoacylase 1 (1)
- Amylose stationary phases (1)
- Anionic surfactant (1)
- Ankle Joint (1)
- Ankle thickness (1)
- Antarctic Polar Plateau (1)
- Antarctic ice sheet (1)
- Antibodies* (1)
- Antibody Induced Arthritis (1)
- Antibody analysis (1)
- Antigen analysis (1)
- Antiphospholipid syndrome (APS) (1)
- Apheresis therapy (1)
- Articular Cartilage (1)
- Aspartoacylase (1)
- Assay development (1)
- Autism (1)
- Autoantibody (1)
- Automated multiple development (1)
- B cells (1)
- B lymphocyte (1)
- B-cell lymphoma (1)
- BAD (1)
- BLAST (1)
- Bacillus (1)
- Background music (1)
- Bacteria, Anaerobic (1)
- Bactericidal effect (1)
- Basis set (1)
- Behcet’s Disease (1)
- Benzyl alkyl ammonium chloride (1)
- Beta-ketothiolase (1)
- Beta-ketothiolase deficiency (1)
- Biomarkers stability (1)
- Biophysics (1)
- Biosignatures (1)
- Biotin (1)
- Block copolymer (1)
- Breast (1)
- CD146 (1)
- CD30+ cells (1)
- CD40 (1)
- CD40, CTLA-4 (1)
- CDH1 (1)
- CE-LIF (1)
- CFTR (1)
- CFTR inhibitors (1)
- CFTR mutations (1)
- CHRNA (1)
- CIBERSORT (1)
- CIK-Zellen (1)
- CLL (1)
- CO (1)
- CR2 (1)
- CREBBP (1)
- Cancer (1)
- Capillary electrophoresis (1)
- Carbapenem (1)
- Carboxy-terminal fragments (1)
- Carcinogenic (1)
- Cartilage Destruction (1)
- Caspase (1)
- Cationic surfactant (1)
- Cell activation (1)
- Cellulose stationary phases (1)
- Ceramides (1)
- Cervical cancer screening (1)
- Cervicovaginal microbiome (1)
- Chaetocin (1)
- Chalcogenide glass sensor (1)
- Chiral stationary phases (1)
- Cholesterol (1)
- Cislunar (1)
- Cognition (1)
- Collision induced dissociation (1)
- Color/Spot-Test (1)
- Colposcopy (1)
- Complement (1)
- Complement receptor 2 (1)
- Complement receptor 2 /CD21 (1)
- Comprehensive two-dimensional liquid chromatography (1)
- Computer Graphics (1)
- Confocal microscopy (1)
- Cross-sensitivity (1)
- Cytochrome c (1)
- Cytokine (1)
- Cytokine-induced killer (CIK) cells (1)
- DADA2 (1)
- DBSdried blot spots (1)
- DEG/ENaC family (1)
- DIDMOAD (1)
- DNA double- strand breaks (1)
- DNA extraction protocols (1)
- DNA profile (1)
- Daptomycin (1)
- Database Management Systems (1)
- Databases, Factual (1)
- Deficiency of ADA2 (1)
- Degraded DNA (1)
- Dehydrogenase (1)
- Delta-ENaC (1)
- Diaminphenylderivat (1)
- Diselenide bridge (1)
- Docking (1)
- Dried serum spots (1)
- Drift tube (1)
- Drug resistance (1)
- Dystonia (1)
- E-cadherin (1)
- EPHB2 (1)
- ER stress (1)
- ERO1α (1)
- ESKAPEE pathogens (1)
- Ectodomain shedding (1)
- Electronic tongue (1)
- Elephantiasis (1)
- Enantioselective gas chromatography (1)
- Endoplasmatic reticulum (1)
- Endosomes (1)
- Endothelial cells (1)
- Epigenomics (1)
- Epilepsy (1)
- Epithelial-mesenchymal transition (1)
- Epitope mapping: Epitope extraction (1)
- Esterquat (1)
- Evans blue (1)
- Ewing´s Sarcoma Family of Tumors (1)
- ExoMars (1)
- Exome sequencing (1)
- FGR (1)
- FOXA1 (1)
- FOXP3 (1)
- Fabry disease (1)
- Familial glioma (1)
- Fatty acids (1)
- Fatty alcohol alkoxylate (1)
- Fatty alcohol alkoxylates (1)
- Fe-ion radiation (1)
- Fibroblast-like synoviocytes (FLS) (1)
- Food allergy (1)
- Forensic genetics (1)
- Forensic genomics (1)
- Forkhead (1)
- Fructose (1)
- Fuzzy logic (1)
- GC × GC (1)
- GC×GC (1)
- GC–MSgas chromatography–mass spectrometry (1)
- GSK-3b (1)
- Galactic Cosmic Rays (GCRs) (1)
- Garlic (1)
- Gas chromatography (1)
- Gelatin Zymography (1)
- Genomics/methods (1)
- Gesamt-Exom-Sequenzierung (1)
- Glutathione (1)
- Glutathione synthetase (1)
- Glycerate (1)
- Glyceric aciduria (1)
- Glycine N-Acyltransferase (GLYAT) (1)
- Glycine N-acyltransferase (1)
- Glycopeptides (1)
- HDAC inhibitor (1)
- HIF1α (1)
- HILIC (1)
- HMGCL (1)
- HPTLC (1)
- HPV diagnostic (1)
- HSD10 (1)
- HSP90 (1)
- Health care policy (1)
- High hyperdiploidy (1)
- High performance liquid chromatography (1)
- Histamine (1)
- Histamine receptors (1)
- Humans (1)
- Hydrophobic interaction (1)
- Hydrophobicity (1)
- Hypoglycemia (1)
- IR microspectroscopy (1)
- Ikaros (1)
- Illegal Wildlife Trade (1)
- Immune escape (1)
- Immunoadsorption (1)
- Immunology* (1)
- In silico epitope prediction (1)
- In silico modelling (1)
- Inborn errors of metabolism (1)
- Inherited metabolic disorders (1)
- Inhibitor (1)
- Intellectual disability (1)
- Interactive computer graphics (1)
- Intracellular Ca2+ (1)
- Involution (1)
- Ion mobility (1)
- Ion mobility spectrometer (1)
- Ionizing radiation (1)
- Isoleucine (1)
- Isoleucine degradation (1)
- Joint Destruction (1)
- Juvenile arthritis (JA) (1)
- K/BxN mouse model (1)
- K/B×N model (1)
- Ketoasidoz (1)
- Ketone body synthesis (1)
- Kozak-sequence (1)
- Kriminaltechnik (1)
- LCxLC-MS (1)
- LEF1 (1)
- LET (1)
- LFA-1 (1)
- Laser-induced fluorescence (1)
- Leg (1)
- LeuT (1)
- Leucine (1)
- Leucine degradation (1)
- Ligand -Receptor Interactions* (1)
- Linezolid (1)
- Lipophilicity (1)
- Lipophilicity potential (1)
- Locomotion (1)
- Lymphedema (1)
- Lysosome (1)
- Lysosomes (1)
- MADDMultiple acyl-CoA dehydrogenase deficiency (1)
- MALDI QIT TOF MS (1)
- MCF-10A (1)
- MCT (1)
- MICA/B (1)
- MMP-9 (1)
- MOCS1 (1)
- MP2.5 (1)
- MPV17 monoclonal antibody (1)
- MRPP (1)
- MS/MS peptide sequencing (1)
- MYB (1)
- Macrophage (1)
- Macrophage migration inhibitory factor (1)
- Macrophages (1)
- Mammary (1)
- Marbled crayfish (1)
- Mars environment (1)
- Mars exploration (1)
- Matrix metalloproteases (1)
- Mechanosensitive (1)
- Media in education (1)
- Memory (1)
- Metabolic decompensation (1)
- Metabolic stroke (-like event) (1)
- Methylation (1)
- Methylmalonic acidemia (1)
- Methylmalonic aciduria (1)
- Methylmalonyl-CoAmutase (1)
- Methyltransferase (1)
- Micromanipulation (1)
- Mitochondria (1)
- Mitochondrial DNA depletion syndrome (1)
- Mitochondrial tRNA (1)
- Moco deficiency (1)
- Molecular Sequence Data (1)
- Molecular dynamics (1)
- Molecular modelling (1)
- Molecular rotation (1)
- Molecular surface (1)
- Molybdenum cofactor (1)
- Motion tracking (1)
- Multi-component heavy metal solution (1)
- N-acetylaspartic acid (1)
- N-acylated amino acids (1)
- N-isovalerylglycine (1)
- NGS (1)
- NKG2D (1)
- NO (1)
- NSS family (1)
- Na+ absorption (1)
- Na+/K+ ATPase (1)
- Native mass spectrometry (1)
- Neugeborenenscreening (1)
- Neuropilin (1)
- Next Generation Sequencing (NGS) (1)
- Next generation sequencing (1)
- Nitrogruppe (1)
- Nitrosamine (1)
- Non-covalent interaction MS* (1)
- Nonketotic hyperglycinemia (1)
- OA, organic acids (1)
- OXCT1 (1)
- Occupational safety (1)
- Off-target effects (1)
- Oligodendroglioma (1)
- Orai1 (1)
- Organic acids (1)
- Organic compounds and Functional groups (1)
- Organische Säuren (1)
- Orion (1)
- Oxidative stress (1)
- PCR inhibitors (1)
- PD-1/CTLA-4 (1)
- PDI (1)
- PK-B/Akt (1)
- PLASM (1)
- Partition coefficients (1)
- Patient serum (1)
- Peroxisomes (1)
- Pervanadate (1)
- Pharmacogenetics (1)
- Phase II reaction (1)
- Polymorphism (1)
- Pre-punched filter paper discs (1)
- Pregnancy (1)
- Probabilistic methods (1)
- Prognosis (1)
- Programmed cell death (1)
- Propionic acidemia (1)
- Propionic aciduria (1)
- Propionyl-CoA carboxylase (1)
- Proteasome (1)
- Proteasome maturation (1)
- Protein Conformation (1)
- Protein Folding (1)
- Protein complex analysis (1)
- Protein-protein interaction (1)
- Proteins/chemistry (1)
- Proteome analysis (1)
- Pulmonary epithelium (1)
- Pyroglutamic aciduria (1)
- Quantum mechanical methods (1)
- Quasi equilibrium conditions (1)
- R751L (1)
- RAID (1)
- RAS (1)
- RELA (1)
- RELA haploinsufficiency (1)
- RELA-associated inflammatory disease (1)
- Raman and FTIR spectroscopies (1)
- Random copolymer (1)
- Redox potential (1)
- Relapse (1)
- RhoA GTPases (1)
- S-sulfocysteine (1)
- SAHA (1)
- SARS-COV-2 virus (1)
- SCNN1D (1)
- SERS (1)
- SGN-35 (1)
- SLC6 (1)
- SLC6A14 (1)
- SNPSTR (1)
- SOS-LC (1)
- STARLIFE project (1)
- Schmauchspur (1)
- Schusswaffe (1)
- Seizures (1)
- Selektives Screening (1)
- Selenocysteine (1)
- Sequence Homology, Amino Acid (1)
- Serine (1)
- Sexual assault (1)
- Shear force (1)
- Single sperm cells (1)
- Skin (1)
- Soluble CD21 (1)
- Soluble CD23 (1)
- Space radiation (1)
- Splicing (1)
- Store-operated calcium entry (1)
- Stratum corneum lipids (1)
- Submerge and dry protocol (1)
- Submucosal plexus (1)
- Sulfite oxidase (1)
- Surfactants (1)
- Survey (1)
- Synovial fluid (1)
- Systemic lupus erythomatosus (SLE) (1)
- TNF inhibitors (1)
- TP53 (1)
- Tandem-Massenspektrometrie (1)
- Targeted mass spectrometry (1)
- Telemedicine (1)
- Telogen hair (1)
- Tetramerisation (1)
- Therapeutic antibodies* (1)
- Thiol antioxidants (1)
- Time–kill methodology (1)
- Transcriptional enhancer (1)
- Transgenic mice (1)
- Triangle mesh (1)
- UV-vis spectroscopy (1)
- Urea cycle defect (1)
- Urine organic acid analysis (1)
- Urothione (1)
- User-Computer Interface (1)
- VR (1)
- Valproic acid (1)
- Vascular permeability (1)
- Virtual Environment (1)
- Virtual Memory Palace (1)
- Virtual reality (1)
- Vitamin A acetate isomers (1)
- Vitamin B12/adenosylcobalamin (1)
- Whole-genome sequencing (1)
- Wild Type Mouse (1)
- Wildlife Forensics (1)
- Wnt/β-catenin (1)
- Wolframin (1)
- X-STR (1)
- Xenopus (1)
- Xenopus laevis (1)
- Xenopus oocyte (1)
- Y-STR (1)
- Yeast (1)
- Yersinia toxins (1)
- ZAP-70 (1)
- Zytokin-induzierte Killerzellen (1)
- accelerated iron ions (1)
- acetoacetic acid (1)
- acetone (1)
- actin (1)
- acute (1)
- acute respiratory distress syndrome (1)
- adoptive cell transfer (1)
- air-blood barrier (1)
- airway (1)
- airway rehydration (1)
- airway smooth muscle (1)
- albuminuria (1)
- alkaline phosphatase (1)
- allopurinol (1)
- allosteric communication (1)
- allosteric regulation (1)
- altered mitochondrial homeostasis (1)
- alveolar epithelium (1)
- alveolar fluid (1)
- alveolar fluid transport (1)
- alveoli (1)
- amino acid transport (1)
- amino acid transporter (1)
- amplicon sequencing (1)
- anaplastic lymphoma kinase (1)
- anorganische Schmauchspur (1)
- anti-TNF (1)
- antibody–drug conjugate (1)
- arthritis (1)
- astrobiology (1)
- atopy (1)
- autoimmune disease (1)
- autoimmunity (1)
- autoinflammation (1)
- autoinflammatory (1)
- autoinflammatory diseases (1)
- automated electrophysiology (1)
- automatic segmentation (1)
- automation of sample processing (1)
- bacteria (1)
- bdelloid rotifer (1)
- biochemical fingerprinting (1)
- biochemistry (1)
- biofilm removal (1)
- biofilm-related infections (1)
- bioinformatics (1)
- biomarker (1)
- black fungi (1)
- blebbistatin (1)
- bone marrow failure (1)
- brain tumor (1)
- branched-chain amino acids (1)
- breast cancer (1)
- breathing (1)
- bronchus (1)
- brush cells (1)
- built environment (1)
- cPMP (1)
- cancer progression (1)
- cancer treatment (1)
- cannabidiol, immunotherapy (1)
- carbon monoxide (1)
- carbon monoxide-releasing molecule (1)
- caspase (1)
- caspase-3 (1)
- caspases (1)
- caveolin-1 (1)
- cell division (1)
- chaetocin (1)
- chemical pathology (1)
- chemosensory cells (1)
- childhood (1)
- childhood cancer syndrome (1)
- cholinergic (1)
- chromatin remodeling (1)
- chymotrypsin (1)
- ciclopirox olamine (1)
- clear cell renal cell carcinoma (1)
- clinical study (1)
- clinical trials (1)
- common variable immunodeficiency (1)
- complete basis set limit (1)
- computer vision (1)
- constitutional mismatch repair syndrome (1)
- contraction (1)
- cosmic rays (1)
- cyanide (1)
- cysticfibrosis (1)
- cytoskeleton (1)
- data base search (1)
- deficiency of adenosine deaminase 2 (1)
- degraded DNA (1)
- desert cyanobacteria (1)
- diagnosis and management (1)
- differentiation (1)
- duty ratio (1)
- dynamin (1)
- electrochemical sensor (1)
- electrolyte transport (1)
- electrophysiology (1)
- electroretinography (1)
- electrostatic potential (1)
- endoplasmic reticulum (ER) stress (1)
- enzyme activity (1)
- epilepsy (1)
- epithelial sodium channel (1)
- epithelial sodium channels (1)
- epithelial transport (1)
- epitope mapping (1)
- erbliche Krebssyndrome (1)
- ethacrynic acid (1)
- exon fusion (1)
- extra column band broadening (1)
- extraction-linked bias (1)
- familial Mediterranean fever (1)
- fatty acid metabolism (1)
- fish gill (1)
- flow cytometry (1)
- forensic (1)
- forensic genetics (1)
- four-ply (1)
- fuel (1)
- fungal and bacterial amplicon sequencing (1)
- furin (1)
- fuzzy logic (1)
- gas exchange (1)
- gene expression (1)
- genes (1)
- genetic testing (1)
- genetics (1)
- genetische Testung (1)
- genome sequencing (1)
- genomic data (1)
- genotype-phenotype correlations (1)
- glycerol (1)
- glycerophosphocholine (1)
- growth hormone (1)
- guidelines (1)
- habitability (1)
- healthcare-associated infections (HAI) (1)
- heat shock proteins (1)
- heat shock response (1)
- heavy ion particle (HZE) radations (1)
- heavy metal (1)
- hematopoietic stem cell transplantation (1)
- hepatocellular carcinoma (1)
- heterozygous ALPL mutation (1)
- high-performance liquid chromatography (1)
- high-throughput DNA sequencing (1)
- high-throughput sequencing (1)
- histamine receptor (1)
- histamine receptor antagonist (1)
- histidine decarboxylase (1)
- histone deacetylase inhibitors (1)
- hospital environment (1)
- hospital-acquired infections (1)
- human microbiome (1)
- hydrocarbon (1)
- hypertension (1)
- hypogammaglobulinemia (1)
- hypophosphatasia (1)
- hypoxia (1)
- immune checkpoint inhibition programmed cell death-1 (1)
- immunhistochemistry (1)
- immunodeficiency (1)
- immunology (1)
- infection prevention (1)
- inflammasome (1)
- inherited metabolic disease (1)
- inhibitor (1)
- inorganic pyrophosphate (1)
- insertion (1)
- interactive computer graphics (1)
- interferon γ (1)
- interleukin-1beta (1)
- intrinsic pathway (1)
- ion-selective electrodes (1)
- isoleucine (1)
- isoleucine metabolism (1)
- ketogenesis defects (1)
- ketogenez defektleri (1)
- ketoliz defektleri (1)
- ketolysis defects (1)
- keton bodies (1)
- ketone body synthesis (1)
- klarzelliges Nierenzellkarzinom (1)
- leucine (1)
- leucine degradation (1)
- leukemia (1)
- life on Mars (1)
- life-detection (1)
- lipid (1)
- liquid chromatography (1)
- local lipophilicity (1)
- long interspersed nuclear element-1 (1)
- loss-of-function variants (1)
- lung (1)
- lung cancer (1)
- lung liquid clearance (1)
- lymphocytic (1)
- lysophosphatidylcholine (1)
- mTOR (1)
- macrophages. (1)
- major histocompatibility complex class I polypeptide-related sequence A (MICA) (1)
- mammary gland (1)
- massive parallel sequencing (1)
- member D (NKG2D) (1)
- metabolic acidosis (1)
- metabolic effects (1)
- metabolic integration (1)
- metabolically active cells (1)
- methylmalonic acidaemia (1)
- methylmalonic acidemia (1)
- microbial community structure (1)
- microbial ecology (1)
- microbiome (1)
- microbiome analyses (1)
- microcephaly (1)
- microdialysis (1)
- micromanipulation (1)
- mitochondrial biogenesis (1)
- mitosis (1)
- mixed reality (1)
- mixed-mode chromatography (1)
- molecular docking (1)
- molecular dynamics simulations (1)
- molecular evolution (1)
- molecular motor (1)
- molecular surfaces (1)
- monoclonal antibody (1)
- mouse model (1)
- mp2 (1)
- mucosal ulcers (1)
- multiple myeloma (1)
- multiple myeloma (MM) (1)
- muscarine (1)
- mutation (1)
- myogenesis (1)
- natural killer group 2 (1)
- next generation sequencing (1)
- nicotine and phosphocholine (1)
- nitric oxide (1)
- non-apoptotic roles (1)
- non-small cell lung cancer (1)
- nosocomial infections (1)
- nucleic acids (1)
- nutrient germinants (1)
- octane (1)
- organic acid analysis (1)
- organische Schmauchspur (1)
- outer space (1)
- outside-out (1)
- pH (1)
- paediatric clinical genetics & dysmorphology (1)
- paediatric endocrinology (1)
- paediatric intensive & critical care (1)
- panspermia (1)
- patch clamp (1)
- patch-clamp (1)
- pathogen control (1)
- pathophysiology (1)
- peptide sequencing (1)
- pharmacokinetics (1)
- phenylketonuria (1)
- phosphoethanolamine (1)
- pigments (1)
- planetary protection (1)
- porphyria (1)
- power stroke (1)
- primary airway epithelial cells (1)
- probiotic cleaning (1)
- probiotic-based cleaning formulations (1)
- proliferation (1)
- propan-2-ol (1)
- propionic acidaemia (1)
- propionic acidemia (1)
- protease (1)
- protein microarray (1)
- proteomics (1)
- proximal tubule (1)
- pseudogene (1)
- pure red cell aplasia (1)
- pyridoxal phosphate (1)
- pyrin inflammasome (1)
- quantum mechanics (1)
- radiation (1)
- radioresistance (1)
- recurrent ketoacidotic episodes (1)
- renal cancer (1)
- renal cell carcinoma (1)
- renal tubular cells (1)
- resistance (1)
- retinal degeneration (1)
- rheumatoid arthritis (1)
- rodent (1)
- rodents (1)
- sCD21 (1)
- sFRP-4 (1)
- salt (1)
- screening (1)
- selectivity tuning (1)
- sensitize (1)
- sequencing (1)
- serine-threonine kinase (1)
- serum and glucocorticoid-induced kinase 1 (1)
- sexual assault (1)
- short tandem repeat (1)
- short tandem repeat (STR) (1)
- single-cell RNA-seq (1)
- sirtuins (1)
- skin cancer (1)
- sodium absorption (1)
- sodium/potassium-exchanging ATPase (1)
- solute carrier (1)
- space radiation environment (1)
- sperm cell (1)
- spore resistance (1)
- sporegermination (1)
- stationary phase (1)
- structural biology (1)
- superficially porous particles (1)
- surface sanitization (1)
- surface shape (1)
- surface topology (1)
- surrogate endpoint (1)
- survival (1)
- symbiosis (1)
- system optimization (1)
- tRNA processing (1)
- taste (1)
- temporomandibular joint (1)
- tetrapod (1)
- therapy (1)
- thermophoresis (1)
- three-ply (1)
- tiglyglycine (1)
- transient kinetics (1)
- transient receptor potential vanilloid Type 2 (1)
- transporter (1)
- triiodothyronine (1)
- tumor microenvironment (1)
- tumor-infiltrating immune cells (1)
- two-electrode voltage clamp (1)
- ubiquitination (1)
- unfolded protein response (UPR) (1)
- urethra (1)
- urethral brush cells (1)
- valine catabolic pathway (1)
- valine degradation (1)
- van Deemter curve (1)
- vasculitis (1)
- voltage-independent Na+ channel (1)
- water dimer (1)
- whole genome amplification (WGA) (1)
- whole-exome sequencing (1)
- µCT (1)
- β-catenin (1)
- β-cells (1)
- γ-glutamyl cycle (1)
The ability to breathe air represents a fundamental step in vertebrate evolution that was accompanied by several anatomical and physiological adaptations. The morphology of the air-blood barrier is highly conserved within air-breathing vertebrates. It is formed by three different plies, which are represented by the alveolar epithelium, the basal lamina, and the endothelial layer. Besides these conserved morphological elements, another common feature of vertebrate lungs is that they contain a certain amount of fluid that covers the alveolar epithelium. The volume and composition of the alveolar fluid is regulated by transepithelial ion transport mechanisms expressed in alveolar epithelial cells. These transport mechanisms have been reviewed extensively. Therefore, the present review focuses on the properties and functional significance of the alveolar fluid. How does the fluid enter the alveoli? What is the fate of the fluid in the alveoli? What is the function of the alveolar fluid in the lungs? The review highlights the importance of the alveolar fluid, its volume and its composition. Maintenance of the fluid volume and composition within certain limits is critical to facilitate gas exchange. We propose that the alveolar fluid is an essential element of the air-blood barrier. Therefore, it is appropriate to refer to this barrier as being formed by four plies, namely (1) the thin fluid layer covering the apical membrane of the epithelial cells, (2) the epithelial cell layer, (3) the basal membrane, and (4) the endothelial cells.
Once aberrantly activated, the Wnt/βcatenin pathway may result in uncontrolled proliferation and eventually cancer. Efforts to counter and inhibit this pathway are mainly directed against βcatenin, as it serves a role on the cytoplasm and the nucleus. In addition, speciallygenerated lymphocytes are recruited for the purpose of treating liver cancer. Peripheral blood mononuclear lymphocytes are expanded by the timely addition of interferon γ, interleukin (IL)1β, IL2 and anticluster of differentiation 3 antibody. The resulting cells are called cytokineinduced killer (CIK) cells. The present study utilised these cells and combine them with drugs inhibiting the Wnt pathway in order to examine whether this resulted in an improvement in the killing ability of CIK cells against liver cancer cells. Drugs including ethacrynic acid (EA) and ciclopirox olamine (CPX) were determined to be suitable candidates, as determined by previous studies. Drugs were administered on their own and combined with CIK cells and then a cell viability assay was performed. These results suggest that EAtreated cells demonstrated apoptosis and were significantly affected compared with untreated cells. Unlike EA, CPX killed normal and cancerous cells even at low concentrations. Subsequent to combining EA with CIK cells, the potency of killing was increased and a greater number of cells died, which proves a synergistic action. In summary, EA may be used as an antihepatocellular carcinoma drug, while CPX possesses a high toxicity to cancerous as well as to normal cells. It was proposed that EA should be integrated into present therapeutic methods for cancer.
The actomyosin system generates mechanical work with the execution of the power stroke, an ATP-driven, two-step rotational swing of the myosin-neck that occurs post ATP hydrolysis during the transition from weakly to strongly actin-bound myosin states concomitant with Pi release and prior to ADP dissociation. The activating role of actin on product release and force generation is well documented; however, the communication paths associated with weak-to-strong transitions are poorly characterized. With the aid of mutant analyses based on kinetic investigations and simulations, we identified the W-helix as an important hub coupling the structural changes of switch elements during ATP hydrolysis to temporally controlled interactions with actin that are passed to the central transducer and converter. Disturbing the W-helix/transducer pathway increased actin-activated ATP turnover and reduced motor performance as a consequence of prolonged duration of the strongly actin-attached states. Actin-triggered Pi release was accelerated, while ADP release considerably decelerated, both limiting maximum ATPase, thus transforming myosin-2 into a high-duty-ratio motor. This kinetic signature of the mutant allowed us to define the fractional occupancies of intermediate states during the ATPase cycle providing evidence that myosin populates a cleft-closure state of strong actin interaction during the weak-to-strong transition with bound hydrolysis products before accomplishing the power stroke.
The epithelial sodium channel (ENaC) plays a key role in salt and water homeostasis in tetrapod vertebrates. There are four ENaC subunits (α, β, γ, δ), forming heterotrimeric αβγ- or δβγ-ENaCs. While the physiology of αβγ-ENaC is well understood, for decades the field has stalled with respect to δβγ-ENaC due to the lack of mammalian model organisms. The SCNN1D gene coding for δ-ENaC was previously believed to be absent in rodents, hindering studies using standard laboratory animals. We analysed all currently available rodent genomes and discovered that SCNN1D is present in rodents but was independently lost in five rodent lineages, including the Muridae (mice and rats). The independent loss of SCNN1D in rodent lineages may be constrained by phylogeny and taxon-specific adaptation to dry habitats, however habitat aridity does not provide a selection pressure for maintenance of SCNN1D across Rodentia. A fusion of two exons coding for a structurally flexible region in the extracellular domain of δ-ENaC appeared in the Hystricognathi (a group that includes guinea pigs). This conserved pattern evolved at least 41 Ma ago and represents a new autapomorphic feature for this clade. Exon fusion does not impair functionality of guinea pig (Cavia porcellus) δβγ-ENaC expressed in Xenopus oocytes. Electrophysiological characterisation at the whole-cell and single-channel level revealed conserved biophysical features and mechanisms controlling guinea pig αβγ- and δβγ-ENaC function as compared to human orthologues. Guinea pigs therefore represent commercially available mammalian model animals that will help shed light on the physiological function of δ-ENaC.
Two distinct sequence elements mediate retroviral gene expression in embryonal carcinoma cells
(1987)
The non-filarial and non-communicable disease podoconiosis affects around 4 million people and is characterized by severe leg lymphedema accompanied with painful intermittent acute inflammatory episodes, called acute dermatolymphangioadenitis (ADLA) attacks. Risk factors have been associated with the disease but the mechanisms of pathophysiology remain uncertain. Lymphedema can lead to skin lesions, which can serve as entry points for bacteria that may cause ADLA attacks leading to progression of the lymphedema. However, the microbiome of the skin of affected legs from podoconiosis individuals remains unclear. Thus, we analysed the skin microbiome of podoconiosis legs using next generation sequencing. We revealed a positive correlation between increasing lymphedema severity and non-commensal anaerobic bacteria, especially Anaerococcus provencensis, as well as a negative correlation with the presence of Corynebacterium, a constituent of normal skin flora. Disease symptoms were generally linked to higher microbial diversity and richness, which deviated from the normal composition of the skin. These findings show an association of distinct bacterial taxa with lymphedema stages, highlighting the important role of bacteria for the pathogenesis of podoconiosis and might enable a selection of better treatment regimens to manage ADLA attacks and disease progression.
Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC50 of 50 μM. The binding motif can influence the activity of Hsp90 by hindering ATP accessibility or the release of ADP.