Refine
H-BRS Bibliography
- yes (189) (remove)
Departments, institutes and facilities
- Fachbereich Angewandte Naturwissenschaften (189) (remove)
Document Type
- Article (175)
- Part of a Book (7)
- Preprint (4)
- Bachelor Thesis (1)
- Conference Object (1)
- Master's Thesis (1)
Year of publication
Has Fulltext
- yes (189) (remove)
Keywords
- lignin (7)
- cytokine-induced killer cells (6)
- GC/MS (5)
- Lignin (5)
- drug release (5)
- immunotherapy (5)
- scaffolds (5)
- biomaterial (4)
- osteogenesis (4)
- stem cells (4)
- DNA damage (3)
- ENaC (3)
- Miscanthus (3)
- SERS (3)
- additive (3)
- angiogenesis (3)
- antioxidant (3)
- biomass (3)
- bone tissue engineering (3)
- chemometrics (3)
- extraction (3)
- extremophiles (3)
- hydrogel (3)
- organosolv (3)
- tissue engineering (3)
- CIK cells (2)
- Composites (2)
- DNA typing (2)
- Folin-Ciocalteu assay (2)
- Gene expression (2)
- Graphene (2)
- IR microspectroscopy (2)
- Inborn error of metabolism (2)
- Ketone body (2)
- Mass spectrometry (2)
- Membrane Transport (2)
- Metabolic acidosis (2)
- Miscanthus x giganteus (2)
- Molecular dynamics (2)
- Nano-Systems (2)
- Organic aciduria (2)
- Polymers (2)
- Prognosis (2)
- Pyrolysis (2)
- R-ratio (2)
- SLC (2)
- active packaging (2)
- aluminum bonding wire (2)
- antimicrobial activity (2)
- antioxidant activity (2)
- autophagy (2)
- bacteria (2)
- bio-based polymers (2)
- bioeconomy (2)
- bone regeneration (2)
- cell migration (2)
- classification (2)
- creep (2)
- cytokine-induced killer (CIK) cells (2)
- discriminant analysis (2)
- essential oil (2)
- extraterrestrial analogue (2)
- extremophile (2)
- food waste (2)
- force generation (2)
- fungi (2)
- ketogenesis (2)
- kraft lignin (2)
- life detection (2)
- lifetime prediction (2)
- lignocellulose feedstock (2)
- low-input crops (2)
- melanin (2)
- mesenchymal stem cells (2)
- modeling (2)
- monolignol ratio (2)
- multivariate data processing (2)
- myosin (2)
- natural additives (2)
- organic aciduria (2)
- osteoblast (2)
- osteoclast (2)
- permeability (2)
- photonic sensing (2)
- plant extracts (2)
- poly(butylene adipate terephthalate) (2)
- poly(lactic acid) (2)
- power electronics (2)
- scaffold (2)
- shelf life (2)
- small-scale fatigue testing (2)
- stress response (2)
- sustainable packaging (2)
- total phenol content (2)
- ultrapure water (2)
- (poly)saccharides (1)
- 16S rRNA gene sequencing (1)
- 2B4 (1)
- 3-hydroxy-n-butyric acid (1)
- 3-hydroxyisobutyrate dehydrogenase (1)
- 3-hydroxyisobutyrate dehydrogenase deficiency (1)
- 3-hydroxyisobutyric aciduria (1)
- ACAT1 (1)
- ACacylcarnitines (1)
- ADP release (1)
- AMAtypical myopathy (1)
- AOP (1)
- APC superfamily (1)
- ATB0,+ (1)
- ATPase cycle (1)
- ATR-FTIR (1)
- Abies nordmanniana (1)
- Abies procera (1)
- Additiv (1)
- Additive (1)
- Adipogenic effect (1)
- Adipose tissue-derived stem cells (1)
- Affinity proteomics (1)
- Aloe vera (1)
- Ankle Joint (1)
- Antarctic Polar Plateau (1)
- Antarctic ice sheet (1)
- Anti-inflammatory effects (1)
- Antibodies* (1)
- Antibody Induced Arthritis (1)
- Antioxidant capacity (1)
- Antioxidative Capacity (1)
- Antioxidatives Potential (1)
- Articular Cartilage (1)
- Assay development (1)
- Assay reproducibility (1)
- Asymmetric cell division (1)
- Atlantic coast (1)
- AuNPs (1)
- Automation (1)
- Automobilindustrie (1)
- Automotive Industry (1)
- BLAST (1)
- Bacillus (1)
- Bacteria, Anaerobic (1)
- Beta-ketothiolase (1)
- BioMark HD microfluidic system (1)
- Bioactive (1)
- Bioaktiv (1)
- Biological databases (1)
- Biophysics (1)
- Biopolymers (1)
- Bone marrow-derived stem cells (1)
- Breast cancer (1)
- CD30+ cells (1)
- CD40, CTLA-4 (1)
- CDH1 (1)
- CDKN1B (1)
- CFTR inhibitors (1)
- CFTR mutations (1)
- CIK-Zellen (1)
- Calcium (1)
- Calcium Intracellular Release (1)
- Cancer (1)
- Cannabinoids (1)
- Cardiovascular Disease (1)
- Cartilage Destruction (1)
- Cathepsin K (1)
- Cell Cycle (1)
- Cell Differentiation (1)
- Cell Signaling (1)
- Cell lineage (1)
- Cervical cancer screening (1)
- Cervicovaginal microbiome (1)
- Chaetocin (1)
- Chemical calculations (1)
- Chemical imaging (1)
- Chemometrics (1)
- Chemotherapy (1)
- Chromatography (1)
- Cislunar (1)
- Classification (1)
- Colposcopy (1)
- Compressive strength (1)
- Corrosion protction (1)
- DBSdried blot spots (1)
- DNA (1)
- DNA Transcription (1)
- DNA double- strand breaks (1)
- DNA extraction protocols (1)
- DNA interaction (1)
- DNA methylation (1)
- DNA profile (1)
- Development (1)
- Docking (1)
- E-cadherin (1)
- E/I balance (1)
- ER stress (1)
- ERO1α (1)
- ESKAPEE pathogens (1)
- Elephantiasis (1)
- Endosomes (1)
- Epitope mapping: Epitope extraction (1)
- European horse chestnut (1)
- Eutectic Ti-Fe alloys (1)
- Explosives (1)
- Extrusionsblasformen (1)
- FMR1 (1)
- Fabry disease (1)
- Familial glioma (1)
- Fe-ion radiation (1)
- Fiber reinforcement (1)
- Foaming (1)
- Forensic genetics (1)
- Fragile X Syndrome (1)
- GC–MSgas chromatography–mass spectrometry (1)
- GMX1778 (1)
- Galactic Cosmic Rays (GCRs) (1)
- Gasturbinenschaufel (1)
- Gelatin Zymography (1)
- Genes (1)
- Geopolymer (1)
- Glycine N-acyltransferase (1)
- Glycine conjugation (1)
- Growth (1)
- HIBADH (1)
- HIBADH deficiency (1)
- HMGCL (1)
- HPV diagnostic (1)
- HS SPME (1)
- HSP90 (1)
- HSQC NMR (1)
- High temperature deformation (1)
- High temperature laser powder bed fusion (1)
- Homeobox (1)
- Humans (1)
- Hyperammonemia (1)
- Hypoglycemia (1)
- ICP OES (1)
- Illegal Wildlife Trade (1)
- Immune escape (1)
- Immunology* (1)
- In silico epitope prediction (1)
- In silico modelling (1)
- Inhibitor (1)
- Intact proinsulin (1)
- Ionic liquids (1)
- Isoleucine (1)
- Isovaleric acidemia (1)
- Joint Destruction (1)
- K/BxN (1)
- Karl Fischer titration (1)
- Ketogenesis (1)
- Ketolysis (1)
- Kriechen (1)
- LET (1)
- LFA-1 (1)
- LSPR (1)
- Lebensdauervorhersage (1)
- Leg (1)
- LeuT (1)
- Leucine (1)
- Ligand -Receptor Interactions* (1)
- Linear viscoelasticity (1)
- Lineare Viskoelastizität (1)
- Liquid crystal (1)
- Liquid-liquid extraction (LLE) (1)
- Lymphedema (1)
- Lysosomes (1)
- MADDMultiple acyl-CoA dehydrogenase deficiency (1)
- MCT (1)
- MICA/B (1)
- MMP-9 (1)
- MOX gas sensors (1)
- MPV17 monoclonal antibody (1)
- Machine learning (1)
- Malus genotypes (1)
- Mars (1)
- Mars environment (1)
- Mass transport (1)
- Meat-associated Microorganisms (1)
- Mechanical properties of materials (1)
- Mechanische Prüfung (1)
- Mesenchymal stromal cells (1)
- Metabolic decompensation (1)
- Metabolicdecompensation (1)
- Miscanthus nagara (1)
- Miscanthus robustus (1)
- Miscanthus sinensis (1)
- Mitochondria (1)
- Mitochondrial DNA depletion syndrome (1)
- Molecular Dynamics (1)
- Multimodal hyperspectral data (1)
- Mxi-2 (1)
- N-isovalerylglycine (1)
- NAI (1)
- NDVI (1)
- NFκB pathway (1)
- NGS (1)
- NKG2D (1)
- NLRP3 inflammasome (1)
- NSS family (1)
- Nafion™ (1)
- Nanoparticles (1)
- Near-field synchrotron ptychographic X-ray computed tomography (1)
- Nickel-based superalloy (1)
- Nickelbasis-Superlegierung (1)
- Node involvement (1)
- Non-covalent interaction MS* (1)
- O3/UV (1)
- OA, organic acids (1)
- OH-number (1)
- Off-target effects (1)
- Oligodendroglioma (1)
- Orai1 (1)
- Organic acids (1)
- Orion (1)
- P1 receptor (1)
- P2 receptor (1)
- PCR inhibitors (1)
- PD-1/CTLA-4 (1)
- PDI (1)
- PEM electrolysis (1)
- PLASM (1)
- Pathogenic Bacteria (1)
- Pattern recognition (1)
- Patterning (1)
- Paulownia (1)
- Permeation (1)
- Peroxisomes (1)
- Phenyls (1)
- Picea abies (1)
- Picea pungens (1)
- Pleiotropic drug resistance (1)
- Polymorphism (1)
- Polysaccharide derivatives (1)
- Protein complex analysis (1)
- Purinergic signaling (1)
- Pyrolyse-GC/MS (1)
- Pyrolysis GC/MS (1)
- R751L (1)
- Raman Spectroscopy (1)
- Raman spectroscopy (1)
- Raman-microspectroscopy (1)
- Regeneration (1)
- Regenerative medicine (1)
- Resins (1)
- RheoTack analysis (1)
- SAXS (1)
- SCNN1D (1)
- SEC (1)
- SGN-35 (1)
- SHAP (1)
- SLC6 (1)
- SLC6A14 (1)
- SNPSTR (1)
- STARLIFE project (1)
- STF-31 (1)
- Saccharomyces cerevisiae (1)
- Sample digestion (1)
- Schadensanalyse (1)
- Schwindung (1)
- Self-assembling (1)
- Short tandem repeat (STR) (1)
- Silica gel (1)
- Silicon Carbides (1)
- Silphium (1)
- Skin (1)
- Solution chemistry (1)
- Space radiation (1)
- Spectroscopy (1)
- Stem cell differentiation (1)
- Stem cells (1)
- Steroidal saponin (1)
- Store-operated calcium entry (1)
- Supervised classification (1)
- Sweet cherry (Prunus avium L.) (1)
- TOC (1)
- Tap water (1)
- Targeted mass spectrometry (1)
- Therapeutic antibodies* (1)
- Thermal conductivity (1)
- Thermoplastic polyurethanes (1)
- Thyme (1)
- Thymian (1)
- TiO2-coatings (1)
- Transcription Regulation (1)
- Treatment (1)
- UV (1)
- UV Absorption (1)
- UV absorbance (1)
- UV spectrum (1)
- UV-Absorption (1)
- UV-VIS (1)
- UV-vis spectroscopy (1)
- Ultrafine microstructures (1)
- Unconjugated THC-COOH (1)
- Used engine oil (1)
- Vascular Smooth Muscle Cells (1)
- Verzug (1)
- Vibrational microspectroscopy (1)
- Vim3 (1)
- Visceral lipid tissue (1)
- WAXS (1)
- WZB117 (1)
- Whole genome amplification (1)
- Whole-genome sequencing (1)
- Wild Type Mouse (1)
- Wildlife Forensics (1)
- X-STR (1)
- X-ray powder diffraction (XRD) (1)
- XGBoost (1)
- XRD (1)
- Y-STR (1)
- Yeast (1)
- Zytokin-induzierte Killerzellen (1)
- accelerated iron ions (1)
- acetoacetic acid (1)
- acetone (1)
- acidic ethanosolv (1)
- actin (1)
- actinometry (1)
- adhesion factor (1)
- aerogels (1)
- agarose (1)
- alkyl amines (1)
- allosteric communication (1)
- altered mitochondrial homeostasis (1)
- amelogenesis (1)
- amino acid transporter (1)
- amplicon sequencing (1)
- anabolic (1)
- anaplastic lymphoma kinase (1)
- antibiotic prophylaxis (1)
- antibody–drug conjugate (1)
- antiradical activity (1)
- apoptosis (1)
- apple replant disease (ARD) (1)
- ash (1)
- astrobiology (1)
- autism spectrum disorders (1)
- autohydrolysis (1)
- autologous bone graft (1)
- automated electrophysiology (1)
- automated sensor-screening (1)
- automatic measurement validation (1)
- automation of sample processing (1)
- azadipeptide nitrile (1)
- bagasse (1)
- bdelloid rotifer (1)
- beaching (1)
- behavior and cognition (1)
- bio-innovation (1)
- biochemical fingerprinting (1)
- biocomposite (1)
- biofilm removal (1)
- biofilm-related infections (1)
- bioinformatics (1)
- biomarker (1)
- biopolymer (1)
- bio‐based (1)
- black fungi (1)
- blebbistatin (1)
- blood vessel (1)
- blow molding (1)
- blown film (1)
- blown film extrusion (1)
- bone (1)
- bone mineral density (1)
- bone remodeling (1)
- branched-chain amino acids (1)
- breast cancer (1)
- breast carcinoma (1)
- brilliant green (1)
- built environment (1)
- cancer biomarker (1)
- cancer treatment (1)
- cannabidiol, immunotherapy (1)
- caspase (1)
- catabolic (1)
- cell death (1)
- cell division (1)
- cell harvesting (1)
- cell viability (1)
- cementogenesis (1)
- chaetocin (1)
- chain extenders cross-linker (1)
- chain extending cross-linker (1)
- chain-extending cross-linker (1)
- chemosensing (1)
- chiral-nematic (1)
- chitosan (1)
- cholesteric liquid crystals (1)
- cholesteric phase (1)
- clear cell renal cell carcinoma (1)
- clinical trials (1)
- coaxial electrospinning (1)
- coffee ring effect (1)
- collagen (1)
- combination of treatments (1)
- composites (1)
- condensation (1)
- coniferous woods (1)
- core-sheath fibers (1)
- cosmic rays (1)
- creep compliance (1)
- cross-linking (1)
- crystal violet (1)
- crystallinity (1)
- cube in cube model (1)
- cyanohydrazide warhead (1)
- cysteine proteases (1)
- cysticfibrosis (1)
- cytoskeleton (1)
- data base search (1)
- deformation behavior (1)
- degraded DNA (1)
- degree of disintegration (1)
- delta-subunit (1)
- demethylation (1)
- dental implant (1)
- dental stem cells (1)
- dental stem cells immortalization (1)
- dentinogenesis (1)
- dentogenesis (1)
- depolymerization (1)
- desert cyanobacteria (1)
- detaching (1)
- diagnosis and management (1)
- differentiation (1)
- diffusion (1)
- disintegration kinetics (1)
- dissolved ozone (1)
- drug delivery (1)
- drug release materials (1)
- duty ratio (1)
- electroless copper deposition (1)
- electrospinning (1)
- elementary volume (1)
- encapsulation (1)
- endoplasmic reticulum (ER) stress (1)
- endothelial cell (1)
- endothelial cell differentiation (1)
- endothelial cells (1)
- enzyme activity (1)
- epithelial sodium channel (1)
- epitope mapping (1)
- evolution (1)
- exon fusion (1)
- extraction-linked bias (1)
- extrusion blow molding (1)
- fasentin (1)
- fatty acid metabolism (1)
- feature (1)
- fiber composites (1)
- fluorinated salts (1)
- food contact material (1)
- food safety (1)
- food-related bacteria (1)
- forensic (1)
- forensic genetics (1)
- formulation (1)
- fungal and bacterial amplicon sequencing (1)
- gas sensor (1)
- gas turbine blade (1)
- gene expression (1)
- genomic data (1)
- genotype (1)
- geopolymer (1)
- geopolymer foam (1)
- glucose uptake inhibitor (1)
- greenhouse bio-test (1)
- growth factors (1)
- guidelines (1)
- habitability (1)
- halogen bonding (1)
- harvest prediction (1)
- healthcare-associated infections (HAI) (1)
- heavy ion particle (HZE) radations (1)
- helical twisting power (1)
- heterocyclic (1)
- high diagnostic coverage and reliability (1)
- high dynamic range resistance readout (1)
- high-sensitivity C-reactive protein (hsCRP) (1)
- high-throughput DNA sequencing (1)
- high-throughput qRT-PCR (1)
- high-throughput sequencing (1)
- histone deacetylase inhibitors (1)
- homeostatic model assessment (HOMA) (1)
- hospital environment (1)
- hospital-acquired infections (1)
- human cathepsins (1)
- human microbiome (1)
- hydrogen bonding (1)
- hydroxyapatite (1)
- hydroxypropylmethylcellulose (1)
- hypertension (1)
- hypoxia (1)
- iPSCs (1)
- immune checkpoint inhibition programmed cell death-1 (1)
- impact monitoring (1)
- impregnation-reduction (1)
- infection prevention (1)
- infrared spectroscopy (1)
- inherited metabolic disease (1)
- insulin resistance (1)
- intact proinsulin (1)
- integrative Simulation (1)
- integrative simulation (1)
- invasion (1)
- ionic polymer metal (1)
- isoleucine (1)
- ketolysis (1)
- ketone body synthesis (1)
- klarzelliges Nierenzellkarzinom (1)
- leishmaniasis (1)
- leucine (1)
- leucine degradation (1)
- life on Mars (1)
- lignin structure analysis (1)
- lignocellulosic feedstock (1)
- liquid crystal (1)
- liquid crystals (1)
- long interspersed nuclear element-1 (1)
- low molecular weight (1)
- low-level laser therapy (1)
- lymphoma (1)
- massive parallel sequencing (1)
- maturity index (1)
- mechanical properties (1)
- mechanical testing (1)
- mesenchymal stem cell (1)
- mesogens (1)
- metabolically active cells (1)
- metal-oxide-semiconductor gas sensors (1)
- methylmalonic acidaemia (1)
- methylmalonic acidemia (1)
- miR-15 (1)
- miR-498 (1)
- microbial community structure (1)
- microbial contamination (1)
- microbial ecology (1)
- microbiome (1)
- microbiome analyses (1)
- micromanipulation (1)
- microplastic (1)
- microsatellite instability (1)
- migration (1)
- mitochondrial biogenesis (1)
- molecular docking (1)
- molecular dynamics simulations (1)
- molecular mass degradation (1)
- molecular motor (1)
- molecular pathology (1)
- monoclonal antibody (1)
- morphology (1)
- mouse model (1)
- multi-drug response (1)
- multiple myeloma (1)
- multivariate data analysis (1)
- multivariate statistics (1)
- myogenesis (1)
- nanomedicine (1)
- natural fiber (1)
- neoexpression (1)
- neuroendocrine (1)
- next generation sequencing (1)
- nitrile inhibitors (1)
- nitrogen dioxide (1)
- non-apoptotic roles (1)
- non-small cell lung cancer (1)
- non-woven fiber mats (1)
- nondestructive examination (1)
- nosocomial infections (1)
- nutrient germinants (1)
- odontogenic cells (1)
- operando Raman spectroscopies (1)
- organic acid analysis (1)
- organoids (1)
- organosolv lignin (1)
- orthotropes prozessabhängiges Materialverhalten (1)
- orthotropic process-dependent material behavior (1)
- osteogenic potential (1)
- osteoporosis (1)
- outer space (1)
- ozonation (1)
- ozone (1)
- p27 (1)
- panspermia (1)
- partial squares regression (1)
- particulate composite (1)
- patent (1)
- pathogen control (1)
- pathogenic microorganisms (1)
- pathophysiology (1)
- peptide sequencing (1)
- photocatalysis (1)
- photolysis (1)
- photostabiliser (1)
- phytoalexins (1)
- planetary protection (1)
- plastic pollution (1)
- polybutylene adipate terephthalate (1)
- polylactic acid (1)
- polymers (1)
- polyphenols (1)
- polysaccharide (1)
- polyurethane coatings (1)
- potentiometric sensors (1)
- power industry (1)
- power stroke (1)
- pressure sensitive adhesives (1)
- primary airway epithelial cells (1)
- primates (1)
- principal component analysis (1)
- prioritizable ranking (1)
- proanthocyanidins (1)
- probiotic cleaning (1)
- probiotic-based cleaning formulations (1)
- process parameters (1)
- process-induced morphology (1)
- proliferation (1)
- propionic acidaemia (1)
- propionic acidemia (1)
- protease inhibitor (1)
- protein microarray (1)
- prototype apparatus (1)
- pseudogene (1)
- purinergic receptor (1)
- purinergic receptors (1)
- qNMR (1)
- radiation (1)
- radioresistance (1)
- renal cancer (1)
- renal cell carcinoma (1)
- renal tubular cells (1)
- resistance (1)
- retraction speed dependency (1)
- rodent (1)
- rodents (1)
- scratch assay (1)
- seed coat (1)
- semiconducting metal oxide gas sensor array (1)
- sensor array (1)
- sensory characterisation (1)
- sequencing (1)
- sexual assault (1)
- short tandem repeat (1)
- short tandem repeat (STR) (1)
- shrinkage (1)
- sirtuins (1)
- size exclusion chromatography (1)
- slope based signature (1)
- smooth muscle cell (1)
- smooth muscle cell differentiation (1)
- sodium self-inhibition (1)
- soil properties (1)
- sol-gel support (1)
- solute carrier (1)
- solvent exchange (1)
- space radiation environment (1)
- sperm cell (1)
- spore resistance (1)
- sporegermination (1)
- stabilisation (1)
- stabiliser (1)
- staurosporine (1)
- stem cell (1)
- structural biology (1)
- structural coloration (1)
- structure (1)
- supercritical drying (1)
- supramolecular liquid crystals (1)
- surface modification (1)
- surface sanitization (1)
- surrogate endpoint (1)
- survival (1)
- sweet sorghum (1)
- synergistic effect (1)
- temperature influence (1)
- therapy (1)
- thermal insulation material (1)
- thermal insulation materials (1)
- thermo-mechanical properties (1)
- thermophoresis (1)
- thermosensing (1)
- thin film (1)
- time series analysis (1)
- total phenolic content (1)
- transcriptional regulation (1)
- transient kinetics (1)
- transient receptor potential vanilloid Type 2 (1)
- triacetone triperoxides (1)
- triiodothyronine (1)
- triphenylmethane dyes (1)
- tumor diagnosis (1)
- tunable pitch (1)
- tunable sheet resistance (1)
- tungsten oxides (1)
- two-electrode voltage clamp (1)
- type 2 diabetes (1)
- unfolded protein response (UPR) (1)
- valine degradation (1)
- volatile organic compound (VOC) sensing (1)
- warpage (1)
- wearable technology (1)
- whole genome amplification (WGA) (1)
- whole-tooth regeneration (1)
- wound healing assay (1)
- yin-yang effect (1)
- zona pellucida protein 2 ZP2 (1)
- β-amino acids (1)
- β-catenin (1)
- β-cell dysfunction (1)
Our study shows ZP2 to be a new biomarker for diagnosis, best used in combination with other low abundant genes in colon cancer. Furthermore, ZP2 promotes cell proliferation via the ERK1/2-cyclinD1-signaling pathway. We demonstrate that ZP2 mRNA is expressed in a low-abundant manner with high specificity in subsets of cancer cell lines representing different cancer subtypes and also in a significant proportion of primary colon cancers. The potential benefit of ZP2 as a biomarker is discussed. In the second part of our study, the function of ZP2 in cancerogenesis has been analyzed. Since ZP2 shows an enhanced transcript level in colon cancer cells, siRNA experiments have been performed to verify the potential role of ZP2 in cell proliferation. Based on these data, ZP2 might serve as a new target molecule for cancer diagnosis and treatment in respective cancer types such as colon cancer.
Several species of (poly)saccharides and organic acids can be found often simultaneously in various biological matrices, e.g., fruits, plant materials, and biological fluids. The analysis of such matrices sometimes represents a challenging task. Using Aloe vera (A. vera) plant materials as an example, the performance of several spectroscopic methods (80 MHz benchtop NMR, NIR, ATR-FTIR and UV-Vis) for the simultaneous analysis of quality parameters of this plant material was compared. The determined parameters include (poly)saccharides such as aloverose, fructose and glucose as well as organic acids (malic, lactic, citric, isocitric, acetic, fumaric, benzoic and sorbic acids). 500 MHz NMR and high-performance liquid chromatography (HPLC) were used as the reference methods.
UV-VIS data can be used only for identification of added preservatives (benzoic and sorbic acids) and drying agent (maltodextrin) and semiquantitative analysis of malic acid. NIR and MIR spectroscopies combined with multivariate regression can deliver more informative overview of A. vera extracts being able to additionally quantify glucose, aloverose, citric, isocitric, malic, lactic acids and fructose. Low-field NMR measurements can be used for the quantification of aloverose, glucose, malic, lactic, acetic, and benzoic acids. The benchtop NMR method was successfully validated in terms of robustness, stability, precision, reproducibility and limit of detection (LOD) and quantification (LOQ), respectively.
All spectroscopic techniques are useful for the screening of (poly)saccharides and organic acids in plant extracts and should be applied according to its availability as well as information and confidence required for the specific analytical goal. Benchtop NMR spectroscopy seems to be the most feasible solution for quality control of A. vera products.
The actomyosin system generates mechanical work with the execution of the power stroke, an ATP-driven, two-step rotational swing of the myosin-neck that occurs post ATP hydrolysis during the transition from weakly to strongly actin-bound myosin states concomitant with Pi release and prior to ADP dissociation. The activating role of actin on product release and force generation is well documented; however, the communication paths associated with weak-to-strong transitions are poorly characterized. With the aid of mutant analyses based on kinetic investigations and simulations, we identified the W-helix as an important hub coupling the structural changes of switch elements during ATP hydrolysis to temporally controlled interactions with actin that are passed to the central transducer and converter. Disturbing the W-helix/transducer pathway increased actin-activated ATP turnover and reduced motor performance as a consequence of prolonged duration of the strongly actin-attached states. Actin-triggered Pi release was accelerated, while ADP release considerably decelerated, both limiting maximum ATPase, thus transforming myosin-2 into a high-duty-ratio motor. This kinetic signature of the mutant allowed us to define the fractional occupancies of intermediate states during the ATPase cycle providing evidence that myosin populates a cleft-closure state of strong actin interaction during the weak-to-strong transition with bound hydrolysis products before accomplishing the power stroke.
Polyurethane (PU) coatings were successfully produced using unmodified kraft lignin (KL) as an environmentally benign component in contents of up to 80 wt%. Lignin samples were precipitated from industrial black liquor in aqueous solution working at room temperature and different pH levels (pH 2 to pH 5). Lignins were characterized by UV-Vis, FTIR, pyrolysis-GC/MS, SEC and 31P-NMR. Results show a correlation between pH level, OH number and molecular weight Mw of isolated lignins. Lignin-based polyurethane coatings were prepared in an efficient one step synthesis dissolving lignin in THF and PEG425 in an ultrasonic bath followed by addition of 4,4-diphenylmethanediisocyanate (MDI) and triethylamine (TEA). Crosslinking was achieved under very mild conditions (1 hour at room temperature followed by 3 hours at 35 °C). The resulting coatings were characterized regarding their physical properties including ATR-IR, TGA, optical contact angle, light microscopy, REM-EDX and AFM data. Transparent homogeneous films of high flexibility resulted from lignins isolated at pH 4, possessing a temperature resistance up to 160 °C. Swelling tests revealed a resistance against water. Swelling in DMSO depends on index, pH of precipitation and catalyst utilization for PU preparation. According to AFM studies, surface roughness is between 10 and 28 nm.
The development of metals tailored to the metallurgical conditions of laser-based additive manufacturing is crucial to advance the maturity of these materials for their use in structural applications. While efforts in this regard are being carried out around the globe, the use of high strength eutectic alloys have, so far, received minor attention, although previous works showed that rapid solidification techniques can result in ultrafine microstructures with excellent mechanical performance, albeit for small sample sizes. In the present work, a eutectic Ti-32.5Fe alloy has been produced by laser powder bed fusion aiming at exploiting rapid solidification and the capability to produce bulk ultrafine microstructures provided by this processing technique.
Process energy densities between 160 J/mm³ and 180 J/mm³ resulted in a dense and crack-free material with an oxygen content of ~ 0.45 wt.% in which a hierarchical microstructure is formed by µm-sized η-Ti4Fe2Ox dendrites embedded in an ultrafine eutectic β-Ti/TiFe matrix. The microstructure was studied three-dimensionally using near-field synchrotron ptychographic X-ray computed tomography with an actual spatial resolution down to 39 nm to analyse the morphology of the eutectic and dendritic structures as well as to quantify their mass density, size and distribution. Inter-lamellar spacings down to ~ 30–50 nm were achieved, revealing the potential of laser-based additive manufacturing to generate microstructures smaller than those obtained by classical rapid solidification techniques for bulk materials. The alloy was deformed at 600 °C under compressive loading up to a strain of ~ 30% without damage formation, resulting in a compressive yield stress of ~ 800 MPa.
This study provides a first demonstration of the feasibility to produce eutectic Ti-Fe alloys with ultrafine microstructures by laser powder bed fusion that are suitable for structural applications at elevated temperature.
The epithelial sodium channel (ENaC) plays a key role in salt and water homeostasis in tetrapod vertebrates. There are four ENaC subunits (α, β, γ, δ), forming heterotrimeric αβγ- or δβγ-ENaCs. While the physiology of αβγ-ENaC is well understood, for decades the field has stalled with respect to δβγ-ENaC due to the lack of mammalian model organisms. The SCNN1D gene coding for δ-ENaC was previously believed to be absent in rodents, hindering studies using standard laboratory animals. We analysed all currently available rodent genomes and discovered that SCNN1D is present in rodents but was independently lost in five rodent lineages, including the Muridae (mice and rats). The independent loss of SCNN1D in rodent lineages may be constrained by phylogeny and taxon-specific adaptation to dry habitats, however habitat aridity does not provide a selection pressure for maintenance of SCNN1D across Rodentia. A fusion of two exons coding for a structurally flexible region in the extracellular domain of δ-ENaC appeared in the Hystricognathi (a group that includes guinea pigs). This conserved pattern evolved at least 41 Ma ago and represents a new autapomorphic feature for this clade. Exon fusion does not impair functionality of guinea pig (Cavia porcellus) δβγ-ENaC expressed in Xenopus oocytes. Electrophysiological characterisation at the whole-cell and single-channel level revealed conserved biophysical features and mechanisms controlling guinea pig αβγ- and δβγ-ENaC function as compared to human orthologues. Guinea pigs therefore represent commercially available mammalian model animals that will help shed light on the physiological function of δ-ENaC.
Development of colored surfaces by formation of nano-structured aggregates is a widely used strategy in nature to color lightweight structures (e.g. butterflies) without the use of dye pigments. The deposition of nanoscale particles mimics nature in it’s approach coloring surfaces. This work presents sol-gel modification of cellulose surfaces used to form a template for growth of Cu/Cu2O core-shell particles with defined size-distributions. Besides improving the adhesion of the deposited particulate material, the sol-gel matrix serves as a template for the control of particle sizes of the Cu/Cu2O structures, and as a consequence of particle size variation the surface color is tunable. As an example, red color was achieved with an average particle size of 35 nm, and shifts gradually to blue appearance when particles have grown to 80 nm on the sol-gel modified fabric. The copper concentration on representative fabrics is kept low to avoid modifying the textile characteristics and were all in the range of 150–170 mg per g of cellulose material. As a result of copper deposition on the surface of the material, the cellulose fabric also became electrically conductive. Remarkably, the electrical conductivity was found to be dependent on the average particle sizes of the deposits and thus related to the change in observed color. The generation of color by growth of nano-sized particles on sol-gel templates provides a highly promising approach to stain surfaces by physical effects without use of synthetic colorants, which opens a new strategy to improve environmental profile of coloration.
The non-filarial and non-communicable disease podoconiosis affects around 4 million people and is characterized by severe leg lymphedema accompanied with painful intermittent acute inflammatory episodes, called acute dermatolymphangioadenitis (ADLA) attacks. Risk factors have been associated with the disease but the mechanisms of pathophysiology remain uncertain. Lymphedema can lead to skin lesions, which can serve as entry points for bacteria that may cause ADLA attacks leading to progression of the lymphedema. However, the microbiome of the skin of affected legs from podoconiosis individuals remains unclear. Thus, we analysed the skin microbiome of podoconiosis legs using next generation sequencing. We revealed a positive correlation between increasing lymphedema severity and non-commensal anaerobic bacteria, especially Anaerococcus provencensis, as well as a negative correlation with the presence of Corynebacterium, a constituent of normal skin flora. Disease symptoms were generally linked to higher microbial diversity and richness, which deviated from the normal composition of the skin. These findings show an association of distinct bacterial taxa with lymphedema stages, highlighting the important role of bacteria for the pathogenesis of podoconiosis and might enable a selection of better treatment regimens to manage ADLA attacks and disease progression.
Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC50 of 50 μM. The binding motif can influence the activity of Hsp90 by hindering ATP accessibility or the release of ADP.
With increasing life expectancy, demands for dental tissue and whole-tooth regeneration are becoming more significant. Despite great progress in medicine, including regenerative therapies, the complex structure of dental tissues introduces several challenges to the field of regenerative dentistry. Interdisciplinary efforts from cellular biologists, material scientists, and clinical odontologists are being made to establish strategies and find the solutions for dental tissue regeneration and/or whole-tooth regeneration. In recent years, many significant discoveries were done regarding signaling pathways and factors shaping calcified tissue genesis, including those of tooth. Novel biocompatible scaffolds and polymer-based drug release systems are under development and may soon result in clinically applicable biomaterials with the potential to modulate signaling cascades involved in dental tissue genesis and regeneration. Approaches for whole-tooth regeneration utilizing adult stem cells, induced pluripotent stem cells, or tooth germ cells transplantation are emerging as promising alternatives to overcome existing in vitro tissue generation hurdles. In this interdisciplinary review, most recent advances in cellular signaling guiding dental tissue genesis, novel functionalized scaffolds and drug release material, various odontogenic cell sources, and methods for tooth regeneration are discussed thus providing a multi-faceted, up-to-date, and illustrative overview on the tooth regeneration matter, alongside hints for future directions in the challenging field of regenerative dentistry.
Therapeutic Treatments for Osteoporosis-Which Combination of Pills Is the Best among the Bad?
(2022)
Osteoporosis is a chronical, systemic skeletal disorder characterized by an increase in bone resorption, which leads to reduced bone density. The reduction in bone mineral density and therefore low bone mass results in an increased risk of fractures. Osteoporosis is caused by an imbalance in the normally strictly regulated bone homeostasis. This imbalance is caused by overactive bone-resorbing osteoclasts, while bone-synthesizing osteoblasts do not compensate for this. In this review, the mechanism is presented, underlined by in vitro and animal models to investigate this imbalance as well as the current status of clinical trials. Furthermore, new therapeutic strategies for osteoporosis are presented, such as anabolic treatments and catabolic treatments and treatments using biomaterials and biomolecules. Another focus is on new combination therapies with multiple drugs which are currently considered more beneficial for the treatment of osteoporosis than monotherapies. Taken together, this review starts with an overview and ends with the newest approaches for osteoporosis therapies and a future perspective not presented so far.
Although p27 plays a central role in cell cycle regulation, its role in breast cancer prognosis is controversial. Furthermore, the p27 gene CDKN1B carries a polymorphism with unknown functional relevance. This study was designed to evaluate p27 expression and p27 genotyping with respect to early breast cancer prognosis. 279 patients with infiltrating metastasis-free breast cancer were included in this study. p27 expression was determined in tumor tissue specimens from 261 patients by immunohistochemistry. From 108 patients, the CDKN1B genotype was examined by PCR and subsequent direct sequencing. 55.2% of the tumors were considered p27 positive. p27 expression did not correlate with any of the established parameters except for nodal involvement but significantly correlated to prolonged disease-free survival. In 35% of the tumors analyzed, the CDKN1B gene showed a polymorphism at codon 109 (V109G). The V109G polymorphism correlated with greater nodal involvement. In the node-negative subgroup, V109G correlated significantly with a shortened disease-free survival. In conclusion, the determination of the CDKN1B genotype might be a powerful tool for the prognosis of patients with early breast cancer.
In 2018, in the US alone, it is estimated that 268,670 people will be diagnosed with breast cancer, and that 41,400 will die from it. Since breast cancers often become resistant to therapies, and certain breast cancers lack therapeutic targets, new approaches are urgently required. A cell-stress response pathway, the unfolded protein response (UPR), has emerged as a promising target for the development of novel breast cancer treatments. This pathway is activated in response to a disturbance in endoplasmic reticulum (ER) homeostasis but has diverse physiological and disease-specific functions. In breast cancer, UPR signalling promotes a malignant phenotype and can confer tumours with resistance to widely used therapies. Here, we review several roles for UPR signalling in breast cancer, highlighting UPR-mediated therapy resistance and the potential for targeting the UPR alone or in combination with existing therapies.
A major challenge modern society has to face is the increasing need for tissue regeneration due to degenerative diseases or tumors, but also accidents or warlike conflicts. There is great hope that stem cell-based therapies might improve current treatments of cardiovascular diseases, osteochondral defects or nerve injury due to the unique properties of stem cells such as their self-renewal and differentiation potential. Since embryonic stem cells raise severe ethical concerns and are prone to teratoma formation, adult stem cells are still in the focus of research. Emphasis is placed on cellular signaling within these cells and in between them for a better understanding of the complex processes regulating stem cell fate. One of the oldest signaling systems is based on nucleotides as ligands for purinergic receptors playing an important role in a huge variety of cellular processes such as proliferation, migration and differentiation. Besides their natural ligands, several artificial agonists and antagonists have been identified for P1 and P2 receptors and are already used as drugs. This review outlines purinergic receptor expression and signaling in stem cells metabolism. We will briefly describe current findings in embryonic and induced pluripotent stem cells as well as in cancer-, hematopoietic-, and neural crest-derived stem cells. The major focus will be placed on recent findings of purinergic signaling in mesenchymal stem cells addressed in in vitro and in vivo studies, since stem cell fate might be manipulated by this system guiding differentiation towards the desired lineage in the future.
One of the primary current astrobiological goals is to understand the limits of microbial resistance to extraterrestrial conditions. Much attention is paid to ionizing radiation, since it can prevent the preservation and spread of life outside the Earth. The aim of this research was to study the impact of accelerated He ions (150 MeV/n, up to 1 kGy) as a component of the galactic cosmic rays on the black fungus C. antarcticus when mixed with Antarctic sandstones—the substratum of its natural habitat—and two Martian regolith simulants, which mimics two different evolutionary stages of Mars. The high dose of 1 kGy was used to assess the effect of dose accumulation in dormant cells within minerals, under long-term irradiation estimated on a geological time scale. The data obtained suggests that viable Earth-like microorganisms can be preserved in the dormant state in the near-surface scenario for approximately 322,000 and 110,000 Earth years within Martian regolith that mimic early and present Mars environmental conditions, respectively. In addition, the results of the study indicate the possibility of maintaining traces within regolith, as demonstrated by the identification of melanin pigments through UltraViolet-visible (UV-vis) spectrophotometric approach.
Background: Staurosporine-dependent single and collective cell migration patterns of breast carcinoma cells MDA-MB-231, MCF-7, and SK-BR-3 were analysed to characterise the presence of drug-dependent migration promoting and inhibiting yin-yang effects. Methods: Migration patterns of various breast cancer cells after staurosporine treatment were investigated using Western blot, cell toxicity assays, single and collective cell migration assays, and video time-lapse. Statistical analyses were performed with Kruskal–Wallis and Fligner–Killeen tests. Results: Application of staurosporine induced the migration of single MCF-7 cells but inhibited collective cell migration. With the exception of low-density SK-BR-3 cells, staurosporine induced the generation of immobile flattened giant cells. Video time-lapse analysis revealed that within the borderline of cell collectives, staurosporine reduced the velocity of individual MDA-MB-231 and SK-BR-3, but not of MCF-7 cells. In individual MCF-7 cells, mainly the directionality of migration became disturbed, which led to an increased migration rate parallel to the borderline, and hereby to an inhibition of the migration of the cell collective as a total. Moreover, the application of staurosporine led to a transient activation of ERK1/2 in all cell lines. Conclusion: Dependent on the context (single versus collective cells), a drug may induce opposite effects in the same cell line.
Mesenchymal stem cells (MSCs) are an attractive cell source for Regenerative Dentistry in particular due to their ability to differentiate towards osteoblasts, among other lineages. Tooth and jaw bone loss are frequent sequelae of traumatic and pathological conditions in both the young and the elderly and must be met by appropriate prosthetic replacements. For successful osseointegration of the dental implant a sufficient bone level is necessary. Besides the utilization of bone autografts or synthetic biomaterials, medical research is more and more focused on the utilization of MSCs. Compared to cells obtained from liposuction material, ectomesenchymal stem cells derived from the head area e.g. out of dental follicles or particulate, non-vascularized bone chips show a higher differentiation potential towards osteoblasts.
The ability to discriminate between different ionic species, termed ion selectivity, is a key feature of ion channels and forms the basis for their physiological function. Members of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily of trimeric ion channels are typically sodium selective, but to a surprisingly variable degree. While acid-sensing ion channels (ASICs) are weakly sodium selective (sodium:potassium ratio ∼10:1), ENaCs show a remarkably high preference for sodium over potassium (>500:1). This discrepancy may be expected to originate from differences in the pore-lining second transmembrane segment (M2). However, these show a relatively high degree of sequence conservation between ASICs and ENaCs, and previous functional and structural studies could not unequivocally establish that differences in M2 alone can account for the disparate degrees of ion selectivity. By contrast, surprisingly little is known about the contributions of the first transmembrane segment (M1) and the preceding pre-M1 region. In this study, we used conventional and noncanonical amino acid-based mutagenesis in combination with a variety of electrophysiological approaches to show that the pre-M1 and M1 regions of mASIC1a channels are major determinants of ion selectivity. Mutational investigations of the corresponding regions in hENaC show that these regions contribute less to ion selectivity, despite affecting ion conductance. In conclusion, our work suggests that the remarkably different degrees of sodium selectivity in ASICs and ENaCs are achieved through different mechanisms. These results further highlight how M1 and pre-M1 are likely to differentially affect pore structure in these related channels.
Exposure to microgravity conditions causes cardiovascular deconditioning in astronauts during spaceflight. Until now, no specific drugs are available for countermeasure, since the underlying mechanism is largely unknown. Endothelial cells (ECs) and smooth muscle cells (SMCs) play key roles in various vascular functions, many of which are regulated by purinergic 2 (P2) receptors. However, their function in ECs and SMCs under microgravity conditions is still unclear. In this study, primary ECs and SMCs were isolated from bovine aorta and verified with specific markers. We show for the first time that the P2 receptor expression pattern is altered in ECs and SMCs after 24 h exposure to simulated microgravity using a clinostat. However, conditioned medium compensates this change in specific P2 receptors, for example, P2X7. Notably, P2 receptors such as P2X7 might be the important players during the paracrine interaction. Additionally, ECs and SMCs secreted different cytokines under simulated microgravity, leading into a pathogenic proliferation and migration. In conclusion, our data indicate P2 receptors might be important players responding to gravity changes in ECs and SMCs. Since some artificial P2 receptor ligands are applied as drugs, it is reasonable to assume that they might be promising candidates against cardiovascular deconditioning in the future.