Refine
H-BRS Bibliography
- yes (241) (remove)
Departments, institutes and facilities
- Institut für funktionale Gen-Analytik (IFGA) (241) (remove)
Document Type
- Article (183)
- Conference Object (32)
- Part of a Book (23)
- Contribution to a Periodical (1)
- Preprint (1)
- Working Paper (1)
Year of publication
Keywords
- cytokine-induced killer cells (9)
- immunotherapy (7)
- Organic aciduria (5)
- CD21 (4)
- ENaC (4)
- Inborn error of metabolism (4)
- Arthritis (3)
- DNA damage (3)
- DNA typing (3)
- K/BxN (3)
- Ketolysis (3)
- Ketone body (3)
- Metabolic acidosis (3)
- apoptosis (3)
- cytokine-induced killer (CIK) cells (3)
- extremophiles (3)
- shedding (3)
- 3-hydroxyisobutyrate dehydrogenase (2)
- 3-hydroxyisobutyric aciduria (2)
- Aminoacylase (2)
- B cell activation (2)
- CIK cells (2)
- Canavan disease (2)
- Complement receptor (2)
- Complement receptor 2/CD21 (2)
- Content Module (2)
- DNA (2)
- Enzyme activity (2)
- Fatty acid metabolism (2)
- Fuzzy logic (2)
- GLYCTK (2)
- Glycine conjugation (2)
- HIBADH (2)
- HIBADH deficiency (2)
- Isovaleric acidemia (2)
- Ketoacidosis (2)
- Ketogenesis (2)
- Ketone body utilization (2)
- Mars (2)
- Mass spectrometry (2)
- Membrane Transport (2)
- Metabolic decompensation (2)
- Original Story (2)
- Rheumatoid arthritis (2)
- SLC (2)
- Shedding (2)
- Short tandem repeat (STR) (2)
- Valproic acid (2)
- Whole genome amplification (2)
- autophagy (2)
- cell death (2)
- d-Glycerate kinase deficiency (2)
- d-Glyceric aciduria (2)
- edutainment (2)
- evolution (2)
- extraterrestrial analogue (2)
- extremophile (2)
- force generation (2)
- fungi (2)
- hypermedia (2)
- ketogenesis (2)
- ketolysis (2)
- life detection (2)
- lymphoma (2)
- melanin (2)
- myosin (2)
- organic aciduria (2)
- 16S rRNA gene sequencing (1)
- 2B4 (1)
- 3-hydroxy-n-butyric acid (1)
- 3-hydroxyisobutyrate dehydrogenase deficiency (1)
- 3-hydroxyisobutyric acid dehydrogenase deficiency (1)
- 3D shape (1)
- 5-Oxoprolinase (1)
- 5-oxoprolinuria (1)
- ACAT1 (1)
- ACacylcarnitines (1)
- ADP release (1)
- AMAtypical myopathy (1)
- AMT (1)
- APC superfamily (1)
- AR (1)
- ASIC (1)
- ASPA (1)
- ATB0,+ (1)
- ATF4 (1)
- ATF6 (1)
- ATPase cycle (1)
- Acute lymphoblastic leukemia (1)
- Acylpeptide hydrolase (1)
- Affinity proteomics (1)
- Algorithms (1)
- Alkane (1)
- Aminoacylase 1 (1)
- Amylose stationary phases (1)
- Ankle Joint (1)
- Ankle thickness (1)
- Antarctic Polar Plateau (1)
- Antarctic ice sheet (1)
- Antibodies* (1)
- Antibody Induced Arthritis (1)
- Antibody analysis (1)
- Antigen analysis (1)
- Antiphospholipid syndrome (APS) (1)
- Apheresis therapy (1)
- Articular Cartilage (1)
- Aspartoacylase (1)
- Assay development (1)
- Augmented reality (1)
- Autism (1)
- Autoantibody (1)
- Autophagy induction (1)
- B cells (1)
- B lymphocyte (1)
- B-cell lymphoma (1)
- BLAST (1)
- Bacillus (1)
- Background music (1)
- Bacteria, Anaerobic (1)
- Bactericidal effect (1)
- Basis set (1)
- BcL-2 family (1)
- Bcl-2 (1)
- Beta-ketothiolase (1)
- Beta-ketothiolase deficiency (1)
- Bicycle Simulator (1)
- Biomarkers stability (1)
- Biophysics (1)
- Biosignatures (1)
- CD146 (1)
- CD30+ cells (1)
- CD40 (1)
- CD40, CTLA-4 (1)
- CDH1 (1)
- CFTR inhibitors (1)
- CFTR mutations (1)
- CIBERSORT (1)
- CIK-Zellen (1)
- CR2 (1)
- CREBBP (1)
- Cancer (1)
- Carbapenem (1)
- Carboxy-terminal fragments (1)
- Carcinogenic (1)
- Cartilage Destruction (1)
- Cell activation (1)
- Cellulose stationary phases (1)
- Cervical cancer screening (1)
- Cervicovaginal microbiome (1)
- Chaetocin (1)
- Chalcogenide glass sensor (1)
- Chiral stationary phases (1)
- Chloroquine (1)
- Chromatogramm (1)
- Chronic lymphocytic leukemia (1)
- Cislunar (1)
- Cognition (1)
- Collision induced dissociation (1)
- Color/Spot-Test (1)
- Colposcopy (1)
- Complement (1)
- Complement receptor 2 (1)
- Complement receptor 2 /CD21 (1)
- Computer Graphics (1)
- Confocal microscopy (1)
- Container Structure (1)
- Cross-sensitivity (1)
- Cytokine (1)
- Cytokine-induced killer (CIK) cells (1)
- DBSdried blot spots (1)
- DIDMOAD (1)
- DNA double- strand breaks (1)
- DNA extraction protocols (1)
- DNA methylation (1)
- DNA profile (1)
- Daptomycin (1)
- Database Management Systems (1)
- Degraded DNA (1)
- Dehydrogenase (1)
- Diaminphenylderivat (1)
- Digital Storytelling (1)
- Diselenide bridge (1)
- Docking (1)
- Dried serum spots (1)
- Drift tube (1)
- Drug resistance (1)
- Dystonia (1)
- E-cadherin (1)
- EEG (1)
- ER stress (1)
- ERO1α (1)
- ESKAPEE pathogens (1)
- Ectodomain shedding (1)
- Electronic tongue (1)
- Elephantiasis (1)
- Enantioselective gas chromatography (1)
- Endoplasmatic reticulum (1)
- Endosomes (1)
- Endothelial cells (1)
- Enzyme activity assays (1)
- Epilepsy (1)
- Epitope mapping: Epitope extraction (1)
- Eriodictyol (1)
- Ewing´s Sarcoma Family of Tumors (1)
- ExoMars (1)
- FGR (1)
- FOXP3 (1)
- Fabry disease (1)
- Familial glioma (1)
- Fe-ion radiation (1)
- Fibroblast-like synoviocytes (FLS) (1)
- Forensic genetics (1)
- Forensic genomics (1)
- Fructose (1)
- GC–MSgas chromatography–mass spectrometry (1)
- Galactic Cosmic Rays (GCRs) (1)
- Gas chromatography (1)
- Gelatin Zymography (1)
- Genomics/methods (1)
- Gesamt-Exom-Sequenzierung (1)
- Glutathione (1)
- Glutathione synthetase (1)
- Glycerate (1)
- Glyceric aciduria (1)
- Glycine N-Acyltransferase (GLYAT) (1)
- Glycine N-acyltransferase (1)
- Glycogen storage disease type (1)
- Glycopeptides (1)
- HCI (1)
- HDAC inhibitor (1)
- HIF1α (1)
- HMGCL (1)
- HPLC Optimierung (1)
- HPV diagnostic (1)
- HSD10 (1)
- HSP90 (1)
- Head-Mounted Displays (1)
- Health care policy (1)
- High hyperdiploidy (1)
- High performance liquid chromatography (1)
- Humans (1)
- Hydroxychloroquine (1)
- Hyperammonemia (1)
- Hypoglycemia (1)
- IR microspectroscopy (1)
- IRE1 (1)
- Ikaros (1)
- Illegal Wildlife Trade (1)
- Immersive Virtual Environments (1)
- Immersive Visualization Environment (1)
- Immune escape (1)
- Immunoadsorption (1)
- Immunology* (1)
- In silico epitope prediction (1)
- In silico modelling (1)
- Inborn errors of metabolism (1)
- Inherited metabolic disorders (1)
- Inhibitor (1)
- Ion mobility (1)
- Ion mobility spectrometer (1)
- Ionizing radiation (1)
- Isoleucine (1)
- Isoleucine degradation (1)
- Joint Destruction (1)
- Juvenile arthritis (JA) (1)
- K/BxN mouse model (1)
- K/B×N model (1)
- Ketoasidoz (1)
- Ketogenic diet (1)
- Ketone body synthesis (1)
- Kozak-sequence (1)
- Kriminaltechnik (1)
- LET (1)
- LFA-1 (1)
- Leg (1)
- LeuT (1)
- Leucine (1)
- Leucine degradation (1)
- Ligand -Receptor Interactions* (1)
- Linezolid (1)
- Locomotion (1)
- Lymphedema (1)
- Lysosome (1)
- Lysosomes (1)
- MADDMultiple acyl-CoA dehydrogenase deficiency (1)
- MALDI QIT TOF MS (1)
- MCT (1)
- MICA/B (1)
- MMP-9 (1)
- MOCS1 (1)
- MP2.5 (1)
- MPV17 monoclonal antibody (1)
- MRPP (1)
- MS/MS peptide sequencing (1)
- Macrophage (1)
- Macrophage migration inhibitory factor (1)
- Macrophages (1)
- Magnetic resonance imaging (MRI) (1)
- Mars environment (1)
- Mars exploration (1)
- Mast cells (1)
- Matrix metalloproteases (1)
- Media in education (1)
- Memory (1)
- Metabolicdecompensation (1)
- Methyltransferase (1)
- Micromanipulation (1)
- Mitochondria (1)
- Mitochondrial DNA depletion syndrome (1)
- Mitochondrial apoptogens (1)
- Mitochondrial outer membrane permeabilization (MOMP) (1)
- Mitochondrial tRNA (1)
- Moco deficiency (1)
- Molecular dynamics (1)
- Molecular rotation (1)
- Molybdenum cofactor (1)
- Monocarboxylate transporter 1 (1)
- Motion tracking (1)
- Movement disorder (1)
- Multi-component heavy metal solution (1)
- N-acetylaspartic acid (1)
- N-acylated amino acids (1)
- N-isovalerylglycine (1)
- NGS (1)
- NKG2D (1)
- NSS family (1)
- Narration Module (1)
- Native mass spectrometry (1)
- Neugeborenenscreening (1)
- Neurometabolic disease (1)
- Neuropilin (1)
- Next Generation Sequencing (NGS) (1)
- Next generation sequencing (1)
- Nitrogruppe (1)
- Nitrosamine (1)
- Non-covalent interaction MS* (1)
- Nonketotic hyperglycinemia (1)
- OA, organic acids (1)
- OXCT1 (1)
- Occupational safety (1)
- Off-target effects (1)
- Oligodendroglioma (1)
- Orai1 (1)
- Organic acids (1)
- Organic compounds and Functional groups (1)
- Organische Säuren (1)
- Orion (1)
- PCR inhibitors (1)
- PD-1/CTLA-4 (1)
- PDI (1)
- PERK (1)
- PLASM (1)
- Pain Reduction (1)
- Partikeltechnologie (1)
- Patient serum (1)
- Peroxisomes (1)
- Pervanadate (1)
- Pharmacogenetics (1)
- Phase II reaction (1)
- Physical exercising game platform (1)
- Polymorphism (1)
- Pre-punched filter paper discs (1)
- Pregnancy (1)
- Probabilistic methods (1)
- Prognosis (1)
- Programmed cell death (1)
- Proteasome (1)
- Proteasome maturation (1)
- Protein complex analysis (1)
- Protein-protein interaction (1)
- Proteome analysis (1)
- Pyroglutamic aciduria (1)
- Quantum mechanical methods (1)
- Quasi equilibrium conditions (1)
- R751L (1)
- RAS (1)
- Raman and FTIR spectroscopies (1)
- Redox potential (1)
- Relapse (1)
- Relative Energies (1)
- Restorative Virtual Environments (1)
- S-sulfocysteine (1)
- SAHA (1)
- SARS-COV-2 virus (1)
- SARS-CoV-2 (1)
- SCNN1D (1)
- SERS (1)
- SGN-35 (1)
- SLC6 (1)
- SLC6A14 (1)
- SNPSTR (1)
- SOS-LC (1)
- STARLIFE project (1)
- Scalable Vector Graphic (1)
- Schmauchspur (1)
- Schusswaffe (1)
- Selektives Screening (1)
- Selenocysteine (1)
- Serine (1)
- Sexual assault (1)
- Silmitasertib (1)
- Single sperm cells (1)
- Skin (1)
- Soluble CD21 (1)
- Soluble CD23 (1)
- Space radiation (1)
- Splicing (1)
- Star Trek (1)
- Store-operated calcium entry (1)
- Story Element (1)
- Stress Management (1)
- Submerge and dry protocol (1)
- Sulfite oxidase (1)
- Survey (1)
- Synovial fluid (1)
- Systemic lupus erythomatosus (SLE) (1)
- TP53 (1)
- Tandem-Massenspektrometrie (1)
- Targeted mass spectrometry (1)
- Telemedicine (1)
- Telogen hair (1)
- Tetramerisation (1)
- Therapeutic antibodies* (1)
- Thiol antioxidants (1)
- Time–kill methodology (1)
- Transgenic mice (1)
- UI design (1)
- UPR signaling (1)
- UV-vis spectroscopy (1)
- Urea cycle defect (1)
- Urinary organic acids (1)
- Urine organic acid analysis (1)
- Urothione (1)
- User-Centered Approach (1)
- User-Computer Interface (1)
- VR (1)
- Vascular permeability (1)
- Virtual Environment (1)
- Virtual Memory Palace (1)
- Virtual Reality (1)
- Virtual reality (1)
- Vitamin A acetate isomers (1)
- Western blot (1)
- Whole-genome sequencing (1)
- Wild Type Mouse (1)
- Wildlife Forensics (1)
- Wnt/β-catenin (1)
- Wolframin (1)
- X-STR (1)
- XBP1 (1)
- Y-STR (1)
- Yeast (1)
- Zytokin-induzierte Killerzellen (1)
- accelerated iron ions (1)
- acetoacetic acid (1)
- acetone (1)
- actin (1)
- acute (1)
- adaptive filters (1)
- adoptive cell transfer (1)
- affective computing (1)
- albuminuria (1)
- alkaline phosphatase (1)
- allopurinol (1)
- allosteric communication (1)
- altered mitochondrial homeostasis (1)
- amino acid transporter (1)
- amplicon sequencing (1)
- anaplastic lymphoma kinase (1)
- anorganische Schmauchspur (1)
- antibody–drug conjugate (1)
- arthritis (1)
- astrobiology (1)
- autoimmune disease (1)
- automated electrophysiology (1)
- automation of sample processing (1)
- autophagy signaling pathways (1)
- bacteria (1)
- bdelloid rotifer (1)
- biochemical fingerprinting (1)
- biochemistry (1)
- biofilm removal (1)
- biofilm-related infections (1)
- bioinformatics (1)
- biomarker (1)
- black fungi (1)
- blebbistatin (1)
- brain computer interfaces (1)
- brain tumor (1)
- branched-chain amino acids (1)
- breast cancer (1)
- built environment (1)
- cPMP (1)
- cancer (1)
- cancer treatment (1)
- cannabidiol, immunotherapy (1)
- caspase (1)
- caspases (1)
- cell division (1)
- chaetocin (1)
- chemical pathology (1)
- chemical sensors (1)
- childhood (1)
- childhood cancer syndrome (1)
- ciclopirox olamine (1)
- clear cell renal cell carcinoma (1)
- clinical study (1)
- clinical trials (1)
- colorimetry (1)
- common variable immunodeficiency (1)
- compensation (1)
- complete basis set limit (1)
- computer vision (1)
- conformations (1)
- constitutional mismatch repair syndrome (1)
- cosmic rays (1)
- cyanide (1)
- cysticfibrosis (1)
- cytoskeleton (1)
- data base search (1)
- degraded DNA (1)
- delta-subunit (1)
- desert cyanobacteria (1)
- diagnosis and management (1)
- differentiation (1)
- digital storytelling (1)
- disabled people (1)
- distributed authoring (1)
- drugs (1)
- duty ratio (1)
- electrochemical sensor (1)
- electroretinography (1)
- emotion computing (1)
- endocytosis (1)
- endoplasmic reticulum (ER) stress (1)
- endoplasmic reticulum stress (1)
- enzyme activity (1)
- epithelial sodium channel (1)
- epithelial transport (1)
- epitope mapping (1)
- erbliche Krebssyndrome (1)
- ethacrynic acid (1)
- exon fusion (1)
- extra column band broadening (1)
- extraction-linked bias (1)
- fatty acid metabolism (1)
- fish gill (1)
- flow cytometry (1)
- forensic (1)
- forensic genetics (1)
- fuel (1)
- fungal and bacterial amplicon sequencing (1)
- fuzzy logic (1)
- gene expression (1)
- genes (1)
- genetic testing (1)
- genetics (1)
- genetische Testung (1)
- genomic data (1)
- glycerol (1)
- growth hormone (1)
- guidelines (1)
- habitability (1)
- healthcare-associated infections (HAI) (1)
- heat shock proteins (1)
- heat shock response (1)
- heavy ion particle (HZE) radations (1)
- heavy metal (1)
- hepatocellular carcinoma (1)
- heterozygous ALPL mutation (1)
- high-performance liquid chromatography (1)
- high-throughput DNA sequencing (1)
- high-throughput sequencing (1)
- histamine receptor (1)
- histamine receptor antagonist (1)
- histidine decarboxylase (1)
- histone deacetylase inhibitors (1)
- hospital environment (1)
- hospital-acquired infections (1)
- human microbiome (1)
- hydrocarbon (1)
- hypermedia applications (1)
- hypertension (1)
- hypogammaglobulinemia (1)
- hypophosphatasia (1)
- immune checkpoint inhibition programmed cell death-1 (1)
- immunhistochemistry (1)
- immunology (1)
- infection prevention (1)
- inherited metabolic disease (1)
- inorganic pyrophosphate (1)
- interactive computer graphics (1)
- interferon γ (1)
- intrinsic pathway (1)
- ion-selective electrodes (1)
- isoleucine (1)
- isoleucine metabolism (1)
- ketogenesis defects (1)
- ketogenez defektleri (1)
- ketoliz defektleri (1)
- ketolysis defects (1)
- keton bodies (1)
- ketone body synthesis (1)
- klarzelliges Nierenzellkarzinom (1)
- leucine (1)
- leucine degradation (1)
- leukemia (1)
- life on Mars (1)
- life-detection (1)
- linguistic variable (1)
- linguistic variables (1)
- lipid (1)
- liquid chromatography (1)
- long interspersed nuclear element-1 (1)
- lung cancer (1)
- lymphocytic (1)
- mTOR (1)
- major histocompatibility complex class I polypeptide-related sequence A (MICA) (1)
- massive parallel sequencing (1)
- member D (NKG2D) (1)
- metabolic acidosis (1)
- metabolic effects (1)
- metabolically active cells (1)
- methylmalonic acidaemia (1)
- methylmalonic acidemia (1)
- microbial community structure (1)
- microbial ecology (1)
- microbiome (1)
- microbiome analyses (1)
- microdialysis (1)
- micromanipulation (1)
- mitochondrial biogenesis (1)
- mixed reality (1)
- mixed-mode chromatography (1)
- molecular docking (1)
- molecular dynamics simulations (1)
- molecular motor (1)
- momentary frequency (1)
- monoclonal antibody (1)
- mp2 (1)
- multiple myeloma (1)
- multiple myeloma (MM) (1)
- mutation (1)
- myogenesis (1)
- natural killer group 2 (1)
- next generation sequencing (1)
- non-apoptotic roles (1)
- non-small cell lung cancer (1)
- nonlinear storytelling (1)
- nosocomial infections (1)
- nucleic acids (1)
- nutrient germinants (1)
- octane (1)
- optimized geometries (1)
- organic acid analysis (1)
- organische Schmauchspur (1)
- outer space (1)
- paediatric clinical genetics & dysmorphology (1)
- paediatric endocrinology (1)
- paediatric intensive & critical care (1)
- panspermia (1)
- pathogen control (1)
- pathophysiology (1)
- peptide sequencing (1)
- pharmacokinetics (1)
- phenylketonuria (1)
- phosphoethanolamine (1)
- photometry (1)
- pigments (1)
- planetary protection (1)
- porphyria (1)
- power stroke (1)
- primary airway epithelial cells (1)
- probiotic cleaning (1)
- probiotic-based cleaning formulations (1)
- proliferation (1)
- propan-2-ol (1)
- propionic acidaemia (1)
- propionic acidemia (1)
- protein microarray (1)
- proteomics (1)
- proximal tubule (1)
- pseudogene (1)
- pyridoxal phosphate (1)
- qPCR (1)
- quantum mechanics (1)
- radiation (1)
- radioresistance (1)
- real-time PCR (1)
- recurrent ketoacidotic episodes (1)
- renal cancer (1)
- renal cell carcinoma (1)
- renal tubular cells (1)
- resistance (1)
- retinal degeneration (1)
- rheumatoid arthritis (1)
- rodent (1)
- rodents (1)
- sCD21 (1)
- screening (1)
- see-through display (1)
- selectivity tuning (1)
- sensitize (1)
- sequencing (1)
- sexual assault (1)
- short tandem repeat (1)
- short tandem repeat (STR) (1)
- sirtuins (1)
- skin cancer (1)
- small molecule (1)
- sodium self-inhibition (1)
- solute carrier (1)
- space radiation environment (1)
- sperm cell (1)
- spore resistance (1)
- sporegermination (1)
- stationary phase (1)
- story authoring (1)
- structural biology (1)
- superficially porous particles (1)
- surface sanitization (1)
- surface topography (1)
- surrogate endpoint (1)
- survival (1)
- system optimization (1)
- tRNA processing (1)
- temporomandibular joint (1)
- therapy (1)
- thermophoresis (1)
- tiglyglycine (1)
- time series processing (1)
- transient kinetics (1)
- transient receptor potential vanilloid Type 2 (1)
- triiodothyronine (1)
- tumor microenvironment (1)
- tumor-infiltrating immune cells (1)
- two-electrode voltage clamp (1)
- unfolded protein response (1)
- unfolded protein response (UPR) (1)
- valine catabolic pathway (1)
- valine degradation (1)
- van Deemter curve (1)
- water dimer (1)
- water-to-land transition (1)
- whole genome amplification (WGA) (1)
- whole-exome sequencing (1)
- µCT (1)
- β-catenin (1)
- β-cells (1)
- γ-glutamyl cycle (1)
"Visual Computing" (VC) fasst als hochgradig aktuelles Forschungsgebiet verschiedene Bereiche der Informatik zusammen, denen gemeinsam ist, dass sie sich mit der Erzeugung und Auswertung visueller Signale befassen. Im Fachbereich Informatik der FH Bonn-Rhein-Sieg nimmt dieser Aspekt eine zentrale Rolle in Lehre und Forschung innerhalb des Studienschwerpunktes Medieninformatik ein. Drei wesentliche Bereiche des VC werden besonders in diversen Lehreinheiten und verschiedenen Projekten vermittelt: Computergrafik, Bildverarbeitung und Hypermedia-Anwendungen. Die Aktivitäten in diesen drei Bereichen fließen zusammen im Kontext immersiver virtueller Visualisierungsumgebungen.
Virtuelle Umgebungen
(2000)
Once aberrantly activated, the Wnt/βcatenin pathway may result in uncontrolled proliferation and eventually cancer. Efforts to counter and inhibit this pathway are mainly directed against βcatenin, as it serves a role on the cytoplasm and the nucleus. In addition, speciallygenerated lymphocytes are recruited for the purpose of treating liver cancer. Peripheral blood mononuclear lymphocytes are expanded by the timely addition of interferon γ, interleukin (IL)1β, IL2 and anticluster of differentiation 3 antibody. The resulting cells are called cytokineinduced killer (CIK) cells. The present study utilised these cells and combine them with drugs inhibiting the Wnt pathway in order to examine whether this resulted in an improvement in the killing ability of CIK cells against liver cancer cells. Drugs including ethacrynic acid (EA) and ciclopirox olamine (CPX) were determined to be suitable candidates, as determined by previous studies. Drugs were administered on their own and combined with CIK cells and then a cell viability assay was performed. These results suggest that EAtreated cells demonstrated apoptosis and were significantly affected compared with untreated cells. Unlike EA, CPX killed normal and cancerous cells even at low concentrations. Subsequent to combining EA with CIK cells, the potency of killing was increased and a greater number of cells died, which proves a synergistic action. In summary, EA may be used as an antihepatocellular carcinoma drug, while CPX possesses a high toxicity to cancerous as well as to normal cells. It was proposed that EA should be integrated into present therapeutic methods for cancer.
The actomyosin system generates mechanical work with the execution of the power stroke, an ATP-driven, two-step rotational swing of the myosin-neck that occurs post ATP hydrolysis during the transition from weakly to strongly actin-bound myosin states concomitant with Pi release and prior to ADP dissociation. The activating role of actin on product release and force generation is well documented; however, the communication paths associated with weak-to-strong transitions are poorly characterized. With the aid of mutant analyses based on kinetic investigations and simulations, we identified the W-helix as an important hub coupling the structural changes of switch elements during ATP hydrolysis to temporally controlled interactions with actin that are passed to the central transducer and converter. Disturbing the W-helix/transducer pathway increased actin-activated ATP turnover and reduced motor performance as a consequence of prolonged duration of the strongly actin-attached states. Actin-triggered Pi release was accelerated, while ADP release considerably decelerated, both limiting maximum ATPase, thus transforming myosin-2 into a high-duty-ratio motor. This kinetic signature of the mutant allowed us to define the fractional occupancies of intermediate states during the ATPase cycle providing evidence that myosin populates a cleft-closure state of strong actin interaction during the weak-to-strong transition with bound hydrolysis products before accomplishing the power stroke.
The epithelial sodium channel (ENaC) plays a key role in salt and water homeostasis in tetrapod vertebrates. There are four ENaC subunits (α, β, γ, δ), forming heterotrimeric αβγ- or δβγ-ENaCs. While the physiology of αβγ-ENaC is well understood, for decades the field has stalled with respect to δβγ-ENaC due to the lack of mammalian model organisms. The SCNN1D gene coding for δ-ENaC was previously believed to be absent in rodents, hindering studies using standard laboratory animals. We analysed all currently available rodent genomes and discovered that SCNN1D is present in rodents but was independently lost in five rodent lineages, including the Muridae (mice and rats). The independent loss of SCNN1D in rodent lineages may be constrained by phylogeny and taxon-specific adaptation to dry habitats, however habitat aridity does not provide a selection pressure for maintenance of SCNN1D across Rodentia. A fusion of two exons coding for a structurally flexible region in the extracellular domain of δ-ENaC appeared in the Hystricognathi (a group that includes guinea pigs). This conserved pattern evolved at least 41 Ma ago and represents a new autapomorphic feature for this clade. Exon fusion does not impair functionality of guinea pig (Cavia porcellus) δβγ-ENaC expressed in Xenopus oocytes. Electrophysiological characterisation at the whole-cell and single-channel level revealed conserved biophysical features and mechanisms controlling guinea pig αβγ- and δβγ-ENaC function as compared to human orthologues. Guinea pigs therefore represent commercially available mammalian model animals that will help shed light on the physiological function of δ-ENaC.
The non-filarial and non-communicable disease podoconiosis affects around 4 million people and is characterized by severe leg lymphedema accompanied with painful intermittent acute inflammatory episodes, called acute dermatolymphangioadenitis (ADLA) attacks. Risk factors have been associated with the disease but the mechanisms of pathophysiology remain uncertain. Lymphedema can lead to skin lesions, which can serve as entry points for bacteria that may cause ADLA attacks leading to progression of the lymphedema. However, the microbiome of the skin of affected legs from podoconiosis individuals remains unclear. Thus, we analysed the skin microbiome of podoconiosis legs using next generation sequencing. We revealed a positive correlation between increasing lymphedema severity and non-commensal anaerobic bacteria, especially Anaerococcus provencensis, as well as a negative correlation with the presence of Corynebacterium, a constituent of normal skin flora. Disease symptoms were generally linked to higher microbial diversity and richness, which deviated from the normal composition of the skin. These findings show an association of distinct bacterial taxa with lymphedema stages, highlighting the important role of bacteria for the pathogenesis of podoconiosis and might enable a selection of better treatment regimens to manage ADLA attacks and disease progression.
Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC50 of 50 μM. The binding motif can influence the activity of Hsp90 by hindering ATP accessibility or the release of ADP.
The Virtual Memory Palace
(2006)
The intention of the Virtual Memory Palace is to help people memorize information by addressing their visual memory. The concept is based on the “Memory Palace” as an ancient Greek memorization technique, where symbols are placed in a certain way within an imaginative building in order to remember the original information whenever the mind goes through the vision of this building again. The goal of this work was to create such a Memory Palace in a virtual environment, so it requires less creative effort of the contemporary learner than was necessary in ancient Greece. The Virtual Memory Palace offers the possibility to freely explore a virtual 3d architectural model and to place icons at various locations within this model. Specific behaviors were assigned to these locations to make them more memorable. To test the benefit of this concept, an experiment with 15 subjects was conducted. The results show a higher remembrance rate of items learned in the Virtual Memory Palace compared to a wordlist. The observations made during the test showed that most of the subjects enjoyed the memorization environment and were astonished how well the Virtual Memory Palace worked for them.
In 2018, in the US alone, it is estimated that 268,670 people will be diagnosed with breast cancer, and that 41,400 will die from it. Since breast cancers often become resistant to therapies, and certain breast cancers lack therapeutic targets, new approaches are urgently required. A cell-stress response pathway, the unfolded protein response (UPR), has emerged as a promising target for the development of novel breast cancer treatments. This pathway is activated in response to a disturbance in endoplasmic reticulum (ER) homeostasis but has diverse physiological and disease-specific functions. In breast cancer, UPR signalling promotes a malignant phenotype and can confer tumours with resistance to widely used therapies. Here, we review several roles for UPR signalling in breast cancer, highlighting UPR-mediated therapy resistance and the potential for targeting the UPR alone or in combination with existing therapies.
Autoantibodies in sera from patients with autoimmune diseases have long been known and have become diagnostic tools. Analysis of their functional role again became popular with the availability of mice mutant for several genes of the complement and Fcγ receptor (FcγR) systems. Evidence from different inflammatory models suggests that both systems are interconnected in a hierarchical way. The complement system mediators such as complement component 5a (C5a) might be crucial in the communication between the complement system and FcγR-expressing cells. The split complement protein C5a is known to inactivate cells by its G-protein-coupled receptor and to be involved in the transcriptional regulation of FcγRs, thereby contributing to the complex regulation of autoimmune disease.
One of the primary current astrobiological goals is to understand the limits of microbial resistance to extraterrestrial conditions. Much attention is paid to ionizing radiation, since it can prevent the preservation and spread of life outside the Earth. The aim of this research was to study the impact of accelerated He ions (150 MeV/n, up to 1 kGy) as a component of the galactic cosmic rays on the black fungus C. antarcticus when mixed with Antarctic sandstones—the substratum of its natural habitat—and two Martian regolith simulants, which mimics two different evolutionary stages of Mars. The high dose of 1 kGy was used to assess the effect of dose accumulation in dormant cells within minerals, under long-term irradiation estimated on a geological time scale. The data obtained suggests that viable Earth-like microorganisms can be preserved in the dormant state in the near-surface scenario for approximately 322,000 and 110,000 Earth years within Martian regolith that mimic early and present Mars environmental conditions, respectively. In addition, the results of the study indicate the possibility of maintaining traces within regolith, as demonstrated by the identification of melanin pigments through UltraViolet-visible (UV-vis) spectrophotometric approach.
The ability to discriminate between different ionic species, termed ion selectivity, is a key feature of ion channels and forms the basis for their physiological function. Members of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily of trimeric ion channels are typically sodium selective, but to a surprisingly variable degree. While acid-sensing ion channels (ASICs) are weakly sodium selective (sodium:potassium ratio ∼10:1), ENaCs show a remarkably high preference for sodium over potassium (>500:1). This discrepancy may be expected to originate from differences in the pore-lining second transmembrane segment (M2). However, these show a relatively high degree of sequence conservation between ASICs and ENaCs, and previous functional and structural studies could not unequivocally establish that differences in M2 alone can account for the disparate degrees of ion selectivity. By contrast, surprisingly little is known about the contributions of the first transmembrane segment (M1) and the preceding pre-M1 region. In this study, we used conventional and noncanonical amino acid-based mutagenesis in combination with a variety of electrophysiological approaches to show that the pre-M1 and M1 regions of mASIC1a channels are major determinants of ion selectivity. Mutational investigations of the corresponding regions in hENaC show that these regions contribute less to ion selectivity, despite affecting ion conductance. In conclusion, our work suggests that the remarkably different degrees of sodium selectivity in ASICs and ENaCs are achieved through different mechanisms. These results further highlight how M1 and pre-M1 are likely to differentially affect pore structure in these related channels.
The reciprocal translocation t(12;21)(p13;q22), the most common structural genomic alteration in B-cell precursor acute lymphoblastic leukaemia in children, results in a chimeric transcription factor TEL-AML1 (ETV6-RUNX1). We identified directly and indirectly regulated target genes utilizing an inducible TEL-AML1 system derived from the murine pro B-cell line BA/F3 and a monoclonal antibody directed against TEL-AML1. By integration of promoter binding identified with chromatin immunoprecipitation (ChIP)-on-chip, gene expression and protein output through microarray technology and stable labelling of amino acids in cell culture, we identified 217 directly and 118 indirectly regulated targets of the TEL-AML1 fusion protein. Directly, but not indirectly, regulated promoters were enriched in AML1-binding sites. The majority of promoter regions were specific for the fusion protein and not bound by native AML1 or TEL. Comparison with gene expression profiles from TEL-AML1-positive patients identified 56 concordantly misregulated genes with negative effects on proliferation and cellular transport mechanisms and positive effects on cellular migration, and stress responses including immunological responses. In summary, this work for the first time gives a comprehensive insight into how TEL-AML1 expression may directly and indirectly contribute to alter cells to become prone for leukemic transformation.
Isovaleric acidemia (IVA), due to isovaleryl-CoA dehydrogenase (IVD) deficiency, results in the accumulation of isovaleryl-CoA, isovaleric acid and secondary metabolites. The increase in these metabolites decreases mitochondrial energy production and increases oxidative stress. This contributes to the neuropathological features of IVA. A general assumption in the literature exists that glycine N-acyltransferase (GLYAT) plays a role in alleviating the symptoms experienced by IVA patients through the formation of N-isovalerylglycine. GLYAT forms part of the phase II glycine conjugation pathway in the liver and detoxifies excess acyl-CoA’s namely benzoyl-CoA. However, very few studies support GLYAT as the enzyme that conjugates isovaleryl-CoA to glycine. Furthermore, GLYATL1, a paralogue of GLYAT, conjugates phenylacetyl-CoA to glutamine. Therefore, GLYATL1 might also be a candidate for the formation of N-isovalerylglycine. Based on the findings from the literature review, we proposed that GLYAT or GLYATL1 can form N-isovalerylglycine in IVA patients. To test this hypothesis, we performed an in-silico analysis to determine which enzyme is more likely to conjugate isovaleryl-CoA with glycine using AutoDock Vina. Thereafter, we performed in vitro validation using purified enzyme preparations. The in-silico and in vitro findings suggested that both enzymes could form N-isovaleryglycine albeit at lower affinities than their preferred substrates. Furthermore, an increase in glycine concentration does not result in an increase in N-isovalerylglycine formation. The results from the critical literature appraisal, in-silico, and in vitro validation, suggest the importance of further investigating the reaction kinetics and binding behaviors between these substrates and enzymes in understanding the pathophysiology of IVA.
Amaç: Keton cisim oluşumu (ketogenez) bozuklukları; mitokondriyel 3-hidroksi-3metil glutaril CoA sentaz (Mhs) ve 3-hidroksi-3-metil glutaril CoA liyaz (HL) enzim eksiklikleri sonucu oluşur. Keton cisim yıkımı (ketoliz) bozuklukları ise suksinil CoA: 3 oksoasit CoA transferaz (SCOT) ve asetoasetil CoA thiolaz-beta ketotiolaz (MAT) enzim eksiklikleri sonucu oluşmaktadır. Keton metabolizma bozukluğu tanısıyla izlenen hastaların klinik ve laboratuvar bulguları ile değerlendirilmesi amaçlandı.
Yöntem: Keton metabolizması bozukluğu tanısıyla izlenen hasta verileri retrospektif olarak incelendi.
Bulgular: Dört hastada HL eksikliği, 3 hastada MAT eksikliği ve 2 hastada SCOT eksikliği tanısı mevcuttu. Hastaların ortanca yaşı 5 yıl (6 ay-15,5 yıl), ilk metabolik dekompanzasyon atak yaşı ortalama 7,7 ay (22 gün-19 ay) idi. MAT eksikliği olan bir hasta, kardeş taraması ile asemptomatik dönemde tanı aldı. İki hastada spastik tetraparezi gibi ağır nörolojik defisit gelişti. Dekompanzasyon ataklarının beslenememe, kusma ve gastroenterit gibi infeksiyon sonrası geliştiği görüldü.
Sonuç: Açıklanamayan metabolik asidoz atakları durumunda keton metabolizma bozuklukları akılda tutulmalıdır. Akut dekompanzasyon değişik yaşlarda ortaya çıkabilir, klinik şiddeti değişken olabilir. Erken tanı ve uygun tedavi mortalite ve morbidite açısından çok önemlidir.
Suprabasal BCL-2 Expression Does Not Sensitize to Chemically-induced Skin Cancer in Transgenic Mice
(2008)
The motor protein myosin drives a wide range of cellular and muscular functions by generating directed movement and force, fueled through adenosine triphosphate (ATP) hydrolysis. Release of the hydrolysis product adenosine diphosphate (ADP) is a fundamental and regulatory process during force production. However, details about the molecular mechanism accompanying ADP release are scarce due to the lack of representative structures. Here we solved a novel blebbistatin-bound myosin conformation with critical structural elements in positions between the myosin pre-power stroke and rigor states. ADP in this structure is repositioned towards the surface by the phosphate-sensing P-loop, and stabilized in a partially unbound conformation via a salt-bridge between Arg131 and Glu187. A 5 Å rotation separates the mechanical converter in this conformation from the rigor position. The crystallized myosin structure thus resembles a conformation towards the end of the two-step power stroke, associated with ADP release. Computationally reconstructing ADP release from myosin by means of molecular dynamics simulations further supported the existence of an equivalent conformation along the power stroke that shows the same major characteristics in the myosin motor domain as the resolved blebbistatin-bound myosin-II·ADP crystal structure, and identified a communication hub centered on Arg232 that mediates chemomechanical energy transduction.
The development of whole-genome amplification (WGA) techniques has opened up new avenues for genetic analysis and genome research, in particular by facilitating the genome-wide analysis of few or even single copies of genomic DNA, such as from single cells (prokaryotic or eukaryotic) or virions. Using WGA, the few copies of genomic DNA obtained from such entities are unspecifically amplified using PCR or PCR-related processes in order to obtain higher DNA quantities that can then be successfully analysed further.
The Concordia Research Station provides a unique location for preparatory activities for future human journey to Mars, to explore microbial diversity at subzero temperatures, and monitor the dissemination of human-associated microorganisms within the pristine surrounding environment. Amplicon sequencing was leveraged to investigate the microbial diversity of surface snow samples collected monthly over a two-year period, at three distances from the Station (10, 500, and 1000 m). Even when the extracted total DNA was below the detection limit, 16S rRNA gene sequencing was successfully performed on all samples, while 18S rRNA was amplified on 19 samples out of 51. No significant relationships were observed between microbial diversity and seasonality (summer or winter) or distance from the Concordia base. This suggested that if present, the anthropogenic impact should have been below the detectable limit. While harboring low microbial diversity, the surface snow samples were characterized by heterogeneous microbiomes. Ultimately, our study corroborated the use of DNA sequencing-based techniques for revealing microbial presence in remote and hostile environments, with implications for Planetary Protection during space missions and for life-detection in astrobiology relevant targets.
The elucidation of conformations and relative potential energies (rPEs) of small molecules has a long history across a diverse range of fields. Periodically, it is helpful to revisit what conformations have been investigated and to provide a consistent theoretical framework for which clear comparisons can be made. In this paper, we compute the minima, first- and second-order saddle points, and torsion-coupled surfaces for methanol, ethanol, propan-2-ol, and propanol using consistent high-level MP2 and CCSD(T) methods. While for certain molecules more rigorous methods were employed, the CCSD(T)/aug-cc-pVTZ//MP2/aug-cc-pV5Z theory level was used throughout to provide relative energies of all minima and first-order saddle points. The rPE surfaces were uniformly computed at the CCSD(T)/aug-cc-pVTZ//MP2/aug-cc-pVTZ level. To the best of our knowledge, this represents the most extensive study for alcohols of this kind, revealing some new aspects. Especially for propanol, we report several new conformations that were previously not investigated. Moreover, two metrics are included in our analysis that quantify how the selected surfaces are similar to one another and hence improve our understanding of the relationship between these alcohols.