Refine
H-BRS Bibliography
- yes (766) (remove)
Departments, institutes and facilities
- Fachbereich Angewandte Naturwissenschaften (766) (remove)
Document Type
- Article (531)
- Conference Object (76)
- Part of a Book (65)
- Doctoral Thesis (26)
- Book (monograph, edited volume) (21)
- Report (20)
- Preprint (9)
- Contribution to a Periodical (6)
- Research Data (4)
- Conference Proceedings (2)
Year of publication
Keywords
- GC/MS (13)
- Lignin (13)
- Lehrbuch (8)
- cytokine-induced killer cells (8)
- lignin (8)
- immunotherapy (7)
- stem cells (7)
- Chemie (6)
- Chemometrics (6)
- drug release (6)
- Biomass (5)
- Chromatography (5)
- Explosives (5)
- Gene expression (5)
- Organic aciduria (5)
- Polymers (5)
- biomaterial (5)
- osteogenesis (5)
- scaffolds (5)
- Analytical pyrolysis (4)
- CD21 (4)
- Corrosion inhibitors (4)
- ENaC (4)
- Inborn error of metabolism (4)
- Ketolysis (4)
- Mass spectrometry (4)
- Mesenchymal stem cells (4)
- Miscanthus (4)
- Regenerative medicine (4)
- Scaffolds (4)
- Tissue engineering (4)
- active packaging (4)
- additive (4)
- angiogenesis (4)
- antioxidant (4)
- apoptosis (4)
- mesenchymal stem cells (4)
- organic aciduria (4)
- organosolv (4)
- pioglitazone (4)
- thiazolidinediones (4)
- tissue engineering (4)
- Analytische Chemie (3)
- Antimicrobial activity (3)
- Antioxidant activity (3)
- Arthritis (3)
- Composites (3)
- Crystallinity (3)
- DNA damage (3)
- DNA typing (3)
- Dielectric analysis (3)
- Failure analysis (3)
- Glycine conjugation (3)
- Isovaleric acidemia (3)
- K/BxN (3)
- Ketogenesis (3)
- Ketone body (3)
- Kriminalistik (3)
- Malaria (3)
- Metabolic acidosis (3)
- Miscanthus x giganteus (3)
- Molecular dynamics (3)
- NMR (3)
- Plasmodium (3)
- Primary long-chain alkyl amines (3)
- Pyrolysis (3)
- Raman spectroscopy (3)
- SERS (3)
- Stem cells (3)
- TD-GC/MS (3)
- alumina (3)
- autophagy (3)
- biomass (3)
- bone (3)
- bone tissue engineering (3)
- chemometrics (3)
- classification (3)
- cytokine-induced killer (CIK) cells (3)
- differentiation (3)
- extraction (3)
- extremophiles (3)
- extrusion blow molding (3)
- hydrogel (3)
- insulin resistance (3)
- metabolic acidosis (3)
- poly(lactic acid) (3)
- preceramic paper (3)
- scaffold (3)
- shedding (3)
- sustainability (3)
- type 2 diabetes (3)
- ultrapure water (3)
- 3-hydroxyisobutyrate dehydrogenase (2)
- 3-hydroxyisobutyric aciduria (2)
- ACAT1 (2)
- AOP (2)
- Additiv (2)
- Additives (2)
- Adipose tissue (2)
- Aluminiumoxid (2)
- Aminoacylase (2)
- Analytical Chemistry (2)
- Analytics (2)
- Analytik (2)
- Anoplophora glabripennis (2)
- Antioxidans (2)
- Antioxidant capacity (2)
- Automotive industry (2)
- B cell activation (2)
- Biomaterials (2)
- Biomineralization (2)
- Bone (2)
- CIK cells (2)
- Canavan disease (2)
- Cathepsin K (2)
- Classification (2)
- Complement receptor (2)
- Complement receptor 2/CD21 (2)
- Complex modulus (2)
- Cysteine proteases (2)
- DMA (2)
- DNA (2)
- DSC (2)
- Dental follicle (2)
- Deoxyhypusine hydroxylase (2)
- Diabetes (2)
- Differentiation (2)
- Discriminant analysis (2)
- Engineering (2)
- Enzyme activity (2)
- Extrusion blow molding (2)
- Fatty acid metabolism (2)
- Folin-Ciocalteu assay (2)
- GC-FID/NPD (2)
- GLYCTK (2)
- Glycine N-acyltransferase (2)
- Graphene (2)
- HIBADH (2)
- HIBADH deficiency (2)
- HMGCL (2)
- HPLC (2)
- HSQC NMR (2)
- Humans (2)
- Hyperspectral image (2)
- IR microspectroscopy (2)
- Ion viscosity (2)
- Ketoacidosis (2)
- Ketone body utilization (2)
- Kinetics (2)
- Lignocellulose feedstock (2)
- Mars (2)
- Massenspektrometrie (2)
- Membrane Transport (2)
- Metabolic decompensation (2)
- Microorganisms (2)
- Mxi-2 (2)
- NMR spectroscopy (2)
- Nano-Systems (2)
- Organic acids (2)
- Organosolv lignin (2)
- Osteogenesis (2)
- Oxidative stress (2)
- Polymorphism (2)
- Principal Components Analysis (2)
- Prognosis (2)
- Pten (2)
- Py-EGA-MS (2)
- R-ratio (2)
- Raman microscopy (2)
- Raman-microspectroscopy (2)
- Renewable resource (2)
- Resins (2)
- Rheumatoid arthritis (2)
- SLC (2)
- Shedding (2)
- Short tandem repeat (STR) (2)
- Spectroscopy (2)
- Spektroskopie (2)
- Styrene (2)
- Sweet cherry (Prunus avium L.) (2)
- TNT (2)
- TOC (2)
- Thyme (2)
- Thymian (2)
- Type 2 diabetes mellitus (2)
- UV (2)
- VOC (2)
- Western Africa (2)
- Whole genome amplification (2)
- adhesion (2)
- aluminum bonding wire (2)
- antimicrobial activity (2)
- antioxidant activity (2)
- azadipeptide nitrile (2)
- bacteria (2)
- bio-based polymers (2)
- biobased (2)
- bioeconomy (2)
- blown film extrusion (2)
- bone regeneration (2)
- breast cancer (2)
- bulk detection (2)
- cardiovascular disease (2)
- cardiovascular risk (2)
- cell death (2)
- cell migration (2)
- coniferous woods (2)
- creep (2)
- cyanohydrazide warhead (2)
- cysteine proteases (2)
- d-Glycerate kinase deficiency (2)
- d-Glyceric aciduria (2)
- dielectric analysis (2)
- diffusion (2)
- discriminant analysis (2)
- essential oil (2)
- evolution (2)
- extraterrestrial analogue (2)
- extremophile (2)
- food loss (2)
- food waste (2)
- food-related bacteria (2)
- force generation (2)
- fruit quality (2)
- fungi (2)
- gas sensor (2)
- gas sensors (2)
- glimepiride (2)
- human cathepsins (2)
- identification (2)
- image fusion (2)
- improvised explosive devices (2)
- inborn error of metabolism (2)
- isoleucine (2)
- ketogenesis (2)
- ketolysis (2)
- ketone body (2)
- kraft lignin (2)
- leucine (2)
- library free detection (2)
- life detection (2)
- lifetime prediction (2)
- lignocellulose feedstock (2)
- low-input crops (2)
- mechanical properties (2)
- melanin (2)
- metabolic decompensation (2)
- migration (2)
- modeling (2)
- monolignol ratio (2)
- morphology (2)
- multivariate data processing (2)
- myosin (2)
- natural additives (2)
- nitrile inhibitors (2)
- osteoblast (2)
- osteoclast (2)
- ozonation (2)
- ozone (2)
- pansharpening (2)
- paper-derived ceramic (2)
- permeability (2)
- photolysis (2)
- photonic sensing (2)
- physical sensors (2)
- plant extracts (2)
- poly(butylene adipate terephthalate) (2)
- polymers (2)
- polyphenols (2)
- power electronics (2)
- pressure sensitive adhesives (2)
- protease inhibitor (2)
- reaction kinetics (2)
- rheology (2)
- shelf life (2)
- small-scale fatigue testing (2)
- stem cell (2)
- stress response (2)
- structure (2)
- sulfonylurea (2)
- sustainable packaging (2)
- thermo-mechanical properties (2)
- total phenol content (2)
- transdermal therapeutic systems (2)
- type 2 diabetes mellitus (2)
- (poly)saccharides (1)
- 1-MCP (1)
- 16S rRNA gene sequencing (1)
- 1H (1)
- 2B4 (1)
- 3-hydroxy-n-butyric acid (1)
- 3-hydroxyisobutyrate dehydrogenase deficiency (1)
- 3-hydroxyisobutyric acid dehydrogenase deficiency (1)
- 31P NMR (1)
- 3D activity landscapes (1)
- 3D-printing (1)
- 5-Oxoprolinase (1)
- 5-oxoprolinuria (1)
- ABTS (1)
- ACacylcarnitines (1)
- ADP release (1)
- AMAtypical myopathy (1)
- AMT (1)
- APC superfamily (1)
- ASIC (1)
- ASPA (1)
- ASR (1)
- ATB0,+ (1)
- ATF4 (1)
- ATF6 (1)
- ATPase cycle (1)
- ATR-FTIR (1)
- Abies nordmanniana (1)
- Abies procera (1)
- Abiotic stress (1)
- Acceleration (1)
- Accuracy (1)
- Acetylcholinesterase (AChE) (1)
- Acorns (1)
- Active site mapping (1)
- Activity-based probes (1)
- Acylpeptide hydrolase (1)
- Additive (1)
- Adipogenesis (1)
- Adipogenic effect (1)
- Adipose tissue-derived stem cells (1)
- AdoMETDC (1)
- Adsorption (1)
- Adult Stem Cells/physiology (1)
- Affinity proteomics (1)
- Agarose (1)
- Age estimation (1)
- Agglomerative Hierarchical Cluster Analysis (1)
- Aglaonema hookerianum (1)
- Ago2 (1)
- Aloe vera (1)
- Alzheimer’s disease (1)
- Aminoacylase 1 (1)
- Amplifiers (1)
- Amylose stationary phases (1)
- Analytics Internship (1)
- Analytik Praktikum (1)
- Angiogenesis (1)
- Ankle Joint (1)
- Ankle thickness (1)
- Antarctic Polar Plateau (1)
- Antarctic ice sheet (1)
- Anti-inflammatory effects (1)
- Antibodies* (1)
- Antibody Induced Arthritis (1)
- Antidepressant (1)
- Antioxidant assays (1)
- Antioxidanz (1)
- Antioxidative Capacity (1)
- Antioxidatives Potential (1)
- Antiphospholipid syndrome (APS) (1)
- Anxiolytic (1)
- Apheresis therapy (1)
- Aphrodisiac effects (1)
- Apple replant disease (1)
- Area under the curve (1)
- Articular Cartilage (1)
- Aspartic acid racemization (1)
- Aspartoacylase (1)
- Assay development (1)
- Assay reproducibility (1)
- Asymmetric cell division (1)
- Atherosclerosis (1)
- Atlantic coast (1)
- AuNPs (1)
- Aufgabensammlung (1)
- Autism (1)
- Autoantibody (1)
- Automated Coating (1)
- Automated PyMS (1)
- Automation (1)
- Automobilindustrie (1)
- Automotive Industry (1)
- Autophagy induction (1)
- B Defects (1)
- B Interfaces (1)
- B cells (1)
- B lymphocyte (1)
- BLAST (1)
- Bacillus (1)
- Bacteria (1)
- Bacteria, Anaerobic (1)
- Bactericidal effect (1)
- Bakterien (1)
- Basiswerkstoff (1)
- BcL-2 family (1)
- Bcl-2 (1)
- Beech wood (1)
- Benzoyl-coenzym A (1)
- Beta-ketothiolase (1)
- Beta-ketothiolase deficiency (1)
- Biaxiality (1)
- BioMark HD microfluidic system (1)
- Bioactive (1)
- Bioactive factors (1)
- Bioactivity (1)
- Bioaktiv (1)
- Bioaktive Verbindung (1)
- Bioaktivität (1)
- Bioassay (1)
- Biobased polymeric material (1)
- Biochemicals (1)
- Biochemische Analyse (1)
- Bioenergy (1)
- Biokompatibilität (1)
- Biological databases (1)
- Biological therapy (1)
- Bioluminescence (1)
- Biomarkers stability (1)
- Biomasse (1)
- Biomaterial (1)
- Biomaterialien (1)
- Biophysics (1)
- Biopolymers (1)
- Biorefinery (1)
- Biosignatures (1)
- Blood glucose meter (1)
- Bond strength (1)
- Bone marrow-derived stem cells (1)
- Breast cancer (1)
- Bulk detection (1)
- Bulk fill (1)
- C-19 steroid (1)
- CD146 (1)
- CD30+ cells (1)
- CD40 (1)
- CD40, CTLA-4 (1)
- CDH1 (1)
- CDKN1B (1)
- CFTR inhibitors (1)
- CFTR mutations (1)
- CIK-Zellen (1)
- CR2 (1)
- CTNNB1 (1)
- CYP2C19 (1)
- CYP2C8 variants (1)
- CYP2C9 (1)
- CYP2D6 (1)
- Caffeine-containing drinks (1)
- Calcium (1)
- Calcium Intracellular Release (1)
- Calorimetry (1)
- Camphorquinone (1)
- Cancer (1)
- Cannabinoids (1)
- Canola (1)
- Carbapenem (1)
- Carbon nanotubes (1)
- Carboxen-poly(dimethylsiloxane) (1)
- Carboxy-terminal fragments (1)
- Cardiovascular Disease (1)
- Cartilage Destruction (1)
- Catalyst Ink (1)
- Catalyst Layer (1)
- Catechins (1)
- Cathepsin B (1)
- Cathepsin S (1)
- Cathepsins (1)
- Cavities (1)
- Cell Cycle (1)
- Cell Differentiation (1)
- Cell Differentiation/physiology (1)
- Cell Signaling (1)
- Cell activation (1)
- Cell lineage (1)
- Cellulose (1)
- Cellulose stationary phases (1)
- Central sensitisation (1)
- Cervical cancer screening (1)
- Cervicovaginal microbiome (1)
- Chaetocin (1)
- Charakterisierung (1)
- Chemical calculations (1)
- Chemical imaging (1)
- Chemical resource (1)
- Chemical structure (1)
- Chemicals (1)
- Chemische Analyse (1)
- Chemometrie (1)
- Chemotherapy (1)
- Chiral stationary phases (1)
- Chiral-nematischer Flüssigkristall (1)
- Chlorophyll fluorescence (1)
- Christmas trees (1)
- Chromatogramm (1)
- Chromatographie (1)
- Chromatographische Analyse, Elektrophorese (1)
- Chronic lymphocytic leukemia (1)
- Cislunar (1)
- Climate change (1)
- Collagen (1)
- Collision induced dissociation (1)
- Color/Spot-Test (1)
- Colposcopy (1)
- Complement (1)
- Complement receptor 2 (1)
- Complement receptor 2 /CD21 (1)
- Composite resin (1)
- Compressive strength (1)
- Confocal microscopy (1)
- Corrosion protction (1)
- Coumarins (1)
- Crack formation (1)
- Cucumber peel waste (1)
- Curie-point pyrolysis (1)
- Curing behavior (1)
- Curing depth (1)
- Curing kinetics (1)
- Cytokine (1)
- Cytokine-induced killer (CIK) cells (1)
- D Multilayer (1)
- D Nickel alloy (1)
- D Zirconium oxide (1)
- DBSdried blot spots (1)
- DIDMOAD (1)
- DMFC (1)
- DNA Transcription (1)
- DNA double- strand breaks (1)
- DNA extraction protocols (1)
- DNA interaction (1)
- DNA methylation (1)
- DNA profile (1)
- DNA profiling (1)
- DOSY (1)
- DPPH (1)
- Daptomycin (1)
- Data fusion (1)
- Defense and security (1)
- Degradation (1)
- Degradation products (1)
- Degraded DNA (1)
- Degree of conversion (1)
- Dehydrogenase (1)
- Dental (1)
- Dental composites (1)
- Dental material (1)
- Dental resin (1)
- Depth Of Cure (1)
- Derivatization with trifluoroacetic anhydride (1)
- Desinfektion (1)
- Detektion von Explosivstoffen (1)
- Development (1)
- Diabetes mellitus (1)
- Diaminphenylderivat (1)
- Didaktik (1)
- Dielectric analysis (DEA) (1)
- Differenzierung (1)
- Dimethacrylate (1)
- Diodes (1)
- Diselenide bridge (1)
- Docking (1)
- Draw ratio (1)
- Drug target (1)
- Duroplast (1)
- Dynamic mechanical analysis (1)
- Dystonia (1)
- E-cadherin (1)
- E. coli (1)
- E/I balance (1)
- EIF-5A (1)
- EPS (1)
- ER stress (1)
- ERO1α (1)
- ESKAPEE pathogens (1)
- Echtzeitüberwachung (1)
- Ectodomain shedding (1)
- Effect of post-irradiation curing (1)
- Einführung (1)
- Electrochemical cells (1)
- Electron beam physical vapor deposition (1)
- Elephantiasis (1)
- Elution (1)
- Enantioselective gas chromatography (1)
- Endoplasmatic reticulum (1)
- Endosomes (1)
- Endothelial cells (1)
- Endothelin-1 (1)
- Engineering plastics (1)
- Enzyme activity assays (1)
- Epilepsy (1)
- Epitope mapping: Epitope extraction (1)
- Ernte (1)
- European horse chestnut (1)
- Eutectic Ti-Fe alloys (1)
- Evaluation of curing (1)
- ExoMars (1)
- Expanded polystyrene (EPS) (1)
- Explosivstoff (1)
- Extrusionsblasformen (1)
- FMR1 (1)
- FOXP3 (1)
- FRAP (1)
- FTIR (1)
- Fabry disease (1)
- Fachrechnen (1)
- Familial glioma (1)
- Fatigue crack growth (1)
- Fe-ion radiation (1)
- Fertigation (1)
- Festigkeitslehre (1)
- Festschrift (1)
- Fiber reinforcement (1)
- Fiber-optic probe (1)
- Fibroblast-like synoviocytes (FLS) (1)
- Filler content (1)
- Fingerprint powder (1)
- Flow direction (1)
- Fluorescence-quenched substrates (1)
- Flüssigkristalline Polymere (1)
- Foaming (1)
- Folin-Ciocalteu (1)
- Folin–Ciocalteu assay (1)
- Food intolerance (1)
- Food packaging (1)
- Food security (1)
- Forensic genetics (1)
- Forensic genomics (1)
- Forschung (1)
- Fourier-transform infrared spectroscopy (1)
- Fragile X Syndrome (1)
- Frequenzauswertung (1)
- Fructose (1)
- Furnace pyrolyzer (1)
- Fährverkehr (1)
- GC (1)
- GC-FID (1)
- GC–MS (1)
- GC–MSgas chromatography–mass spectrometry (1)
- GFRP (1)
- GMX1778 (1)
- Galactic Cosmic Rays (GCRs) (1)
- Gas Chromatography (1)
- Gas chromatography-mass spectrometry (1)
- Gas chromatography/ mass spectrometry (1)
- Gas chromatography/mass spectrometry (GC/MS) (1)
- Gas chromatography–mass spectrometry (1)
- Gas sensors (1)
- Gas turbines (1)
- Gasanalyse (1)
- Gaschromatographie (1)
- Gassensor (1)
- Gasturbinenschaufel (1)
- Gelatin Zymography (1)
- Gene Expression Regulation (1)
- Genes (1)
- Genotoxicity (1)
- Genotyp (1)
- Geopolymer (1)
- Geruchssinn (1)
- Ghanaian children (1)
- Glutamin N-phenylacetyltransferase (1)
- Glutathione (1)
- Glutathione synthetase (1)
- Glycerate (1)
- Glyceric aciduria (1)
- Glycin N-acyltransferase (1)
- Glycine N-Acyltransferase (GLYAT) (1)
- Glycogen storage disease type (1)
- Glycopeptides (1)
- Glyzinkonjugation (1)
- Graft material (1)
- Green fluorescent protein (1)
- Growth (1)
- HPLC Optimierung (1)
- HPTLC (1)
- HPV diagnostic (1)
- HS SPME (1)
- HS SPME–GC/MS (1)
- HSD10 (1)
- HSP90 (1)
- Hands-On Learning/Manipulatives (1)
- Hard tissue (1)
- Hardness mapping (1)
- Harnstoffzyklusdefekt (1)
- Hazardous material detection (1)
- Headspace SPME (1)
- Health care policy (1)
- Heparanase (1)
- Heparin (1)
- Heterogenes Sensorsystem (1)
- Hexamethylene triperoxide diamine (HMTD) (1)
- High performance liquid chromatography (1)
- High performance liquid chromatography – mass-spectrometry (HPLC-MS/MS) (1)
- High speed tensile testing (1)
- High strain rate (1)
- High temperature deformation (1)
- High temperature laser powder bed fusion (1)
- Hochschule (1)
- Hochschule Bonn-Rhein-Sieg (1)
- Home made explosives (1)
- Homemade explosives (1)
- Homeobox (1)
- Horner-Wadsworth-Emmons olefination Irreversible inhibition (1)
- Hydraulic cylinders (1)
- Hyperalgesia (1)
- Hyperammonemia (1)
- Hypoglycemia (1)
- Hypusine (1)
- ICP OES (1)
- IED (1)
- IR-microspectroscopy (1)
- IRE1 (1)
- Identification (1)
- Illegal Wildlife Trade (1)
- Immune escape (1)
- Immunoadsorption (1)
- Immunology* (1)
- Impedance spectroscopy (1)
- Improvised explosive devices (1)
- In silico epitope prediction (1)
- In silico modelling (1)
- Inborn errors of metabolism (1)
- Indentation techniques (1)
- Individualisierte Medizin (1)
- Industrial applications (1)
- Infrared (1)
- Infrarot (1)
- Infrarotmikroskopie (1)
- Inherited metabolic disorders (1)
- Inhibitor (1)
- Innovation (1)
- Instrumental analysis (1)
- Instrumentation (1)
- Insulin glulisine (1)
- Intact proinsulin (1)
- Interface (1)
- Introduction (1)
- Ion mobility (1)
- Ionenbeweglichkeitsspektroskopie (1)
- Ionic liquids (1)
- Ionizing radiation (1)
- Irradiance Distribution (1)
- Irradiance distribution (1)
- Isoleucine (1)
- Isoleucine degradation (1)
- Isomers (1)
- Isotherms (1)
- Isovalerianazidämie (1)
- Joint Destruction (1)
- Juvenile arthritis (JA) (1)
- K/BxN mouse model (1)
- K/B×N model (1)
- Kardioprotektion (1)
- Karl Fischer titration (1)
- Ketoasidoz (1)
- Ketogenic diet (1)
- Ketone body synthesis (1)
- Knochenersatz (1)
- Knochenzement (1)
- Knoop micro-hardness (1)
- Koagulation (1)
- Koaxiales Elektrospinnen (1)
- Kozak-sequence (1)
- Kraft lignin (1)
- Kriechen (1)
- Kriminaltechnik (1)
- Kunststoffverpackung (1)
- LC-HRMS (1)
- LC-MS/MS (1)
- LET (1)
- LFA-1 (1)
- LSPR (1)
- Laboratories and Demonstrations (1)
- Lamellae structure (1)
- Lanthanide luminescence (1)
- Laser drilling (1)
- Laser induced breakdown spectroscopy (1)
- Laser-Beam Profiler (1)
- Laserbohren (1)
- Lasermaterialbearbeitung (1)
- Lebensdauervorhersage (1)
- Lebensmittelverpackungen (1)
- Leg (1)
- LeuT (1)
- Leucine (1)
- Leucine degradation (1)
- Lexikon (1)
- Libido-booster (1)
- Ligand -Receptor Interactions* (1)
- Light Curing Units (1)
- Light attenuation (1)
- Light curing (1)
- Light curing units (1)
- Light limitation (1)
- Light measurement (1)
- Lignin-based composites (1)
- Linear viscoelasticity (1)
- Lineare Viskoelastizität (1)
- Linezolid (1)
- Lipoaspirate (1)
- Lipoaspirates (1)
- Liquid crystal (1)
- Liquid-liquid extraction (LLE) (1)
- Lithium (1)
- Local mechanical properties (1)
- Local process-dependent properties (1)
- Locomotion (1)
- Long-chain N-1-alkyl-1,3-propanediamines (1)
- Low-input crops (1)
- Luftfracht (1)
- Lymphedema (1)
- Lysosome (1)
- Lysosomes (1)
- MADDMultiple acyl-CoA dehydrogenase deficiency (1)
- MALDI QIT TOF MS (1)
- MAP (1)
- MAPO (1)
- MCT (1)
- MICA/B (1)
- MMP-9 (1)
- MOCS1 (1)
- MOX Gassensoren (1)
- MOX gas sensors (1)
- MPV17 monoclonal antibody (1)
- MRPP (1)
- MS (1)
- MS/MS peptide sequencing (1)
- MSCs (1)
- Machine learning (1)
- Macrophage (1)
- Macrophage migration inhibitory factor (1)
- Macrophages (1)
- Magnetic resonance imaging (MRI) (1)
- Mal d 1 (1)
- Malus domestica (1)
- Malus genotypes (1)
- Mapping (1)
- Mars environment (1)
- Mars exploration (1)
- Mass Spectrometry (1)
- Mass transport (1)
- Mast cells (1)
- Materialverarbeitung (1)
- Matrix metalloproteases (1)
- Meat-associated Microorganisms (1)
- Mechanical properties of materials (1)
- Mechanische Prüfung (1)
- Mehrachsigkeit (1)
- Mesenchymal Stromal Cells/cytology (1)
- Mesenchymal stromal cells (1)
- Metabolicdecompensation (1)
- Metal oxide gas sensors (1)
- Metals (1)
- Method validation (1)
- Methylation (1)
- Methyltransferase (1)
- Michael acceptors (1)
- Micro-mechanical properties (1)
- Microcirculation (1)
- Microindentation (1)
- Micromanipulation (1)
- Microplastics (1)
- Miscanthus nagara (1)
- Miscanthus robustus (1)
- Miscanthus sinensis (1)
- Mitochondria (1)
- Mitochondrial DNA depletion syndrome (1)
- Mitochondrial apoptogens (1)
- Mitochondrial outer membrane permeabilization (MOMP) (1)
- Mitochondrial tRNA (1)
- Mobile explosive identification (1)
- Moco deficiency (1)
- Mold temperature (1)
- Molecular Dynamics (1)
- Molecular weight (1)
- Molekulargewicht (1)
- Molybdenum cofactor (1)
- Monocarboxylate transporter 1 (1)
- Motion tracking (1)
- Motivation (1)
- Movement disorder (1)
- Multi-lineage differentiation (1)
- Multilineage potential (1)
- Multimodal hyperspectral data (1)
- Multivariate analysis (1)
- N-acetylaspartic acid (1)
- N-acylated amino acids (1)
- N-isovalerylglycine (1)
- NAI (1)
- NDVI (1)
- NFκB pathway (1)
- NGS (1)
- NKG2D (1)
- NLRP3 inflammasome (1)
- NMR-Spektroskopie (1)
- NSS family (1)
- Nachhaltigkeit (1)
- Nachwachsender Rohstoff (1)
- Nadelhölzer (1)
- Nafion™ (1)
- Nano-systems (1)
- Nanofibers (1)
- Nanoparticles (1)
- Native mass spectrometry (1)
- Naturkautschuk (1)
- Near-field synchrotron ptychographic X-ray computed tomography (1)
- Neugeborenenscreening (1)
- Neurometabolic disease (1)
- Neuropilin (1)
- Neuroprotective (1)
- Next Generation Sequencing (NGS) (1)
- Next generation sequencing (1)
- Next generation sequencing (NGS) (1)
- Nickel-based superalloy (1)
- Nickelbasis-Superlegierung (1)
- Nitriles (1)
- Nitrogruppe (1)
- Node involvement (1)
- Non-covalent interaction MS* (1)
- Non-destructive (1)
- Nonketotic hyperglycinemia (1)
- Nonlinear coefficient (1)
- O3/UV (1)
- OA, organic acids (1)
- OH-Zahl-Bestimmungen (1)
- OH-number (1)
- OXCT1 (1)
- Oak leaf poisoning (1)
- Off-target effects (1)
- Oligodendroglioma (1)
- Optical sensor (1)
- Optische Gassensorik (1)
- Orai1 (1)
- Organische Säuren (1)
- Organosolv (1)
- Organosolv process (1)
- Organosolv-Lignin (1)
- Organosolv-Verfahren (1)
- Orientation averaging (1)
- Orion (1)
- Osteogene Linie (1)
- Osteogenic differentiation (1)
- Osteogenic lineage (1)
- Ovarian cancer (1)
- Oxazolidinone antibiotics (1)
- P1 receptor (1)
- P2 receptor (1)
- P4 medicine (1)
- PCR inhibitors (1)
- PD-1/CTLA-4 (1)
- PDI (1)
- PEM electrolysis (1)
- PERK (1)
- PLASM (1)
- PLS-regression (1)
- PTHrP (1)
- PTR-MS (1)
- PTR-ToF (1)
- Packaging (1)
- Partial least squares regression (1)
- Partikeltechnologie (1)
- Partikelverarbeitung (1)
- Pathogenic Bacteria (1)
- Pattern recognition (1)
- Patterning (1)
- Paulownia (1)
- Paulownia tomemtosa (1)
- Peptidomimetic inhibitors (1)
- Permeation (1)
- Peroxisomes (1)
- Pervanadate (1)
- Pharmacogenetics (1)
- Phase II Reaktion (1)
- Phase II reaction (1)
- Phenol-Formaldehyd-Harze (1)
- Phenole-formaldehyde resin (1)
- Phenolic acids (1)
- Phenylacetyl-coenzym A (1)
- Phenyls (1)
- Photoinitiator (1)
- Photopolymerization (1)
- Phycocyanin lyase (1)
- Physical sensors (1)
- Physiological stress responses in plants (1)
- Picea abies (1)
- Picea pungens (1)
- Plasmid DNA (pBR322) (1)
- Pleiotropic drug resistance (1)
- Poly(acrylonitrile-co-1,3-butadiene-co-styrene)/polyamide 6 (ABS/PA 6) blends (1)
- Polymer Chemistry (1)
- Polymere (1)
- Polymers/copolymers (1)
- Polysaccharide derivatives (1)
- Polyurethan (1)
- Polyurethan-Coatings (1)
- Polyurethanbeschichtungen (1)
- Polyurethane (1)
- Portland cement (1)
- Post-prandial metabolism (1)
- Poultry (1)
- Poultry meat (1)
- Poultry spoilage (1)
- Pregnancy (1)
- Pressure-sensitive adhesive (1)
- Primary explosives (1)
- Principal component analysis (1)
- Probabilistic methods (1)
- Probenahme (1)
- Programmed cell death (1)
- Proliferation (1)
- Promoter methylation (1)
- Propellants (1)
- Prostate cancer (1)
- Proteasome (1)
- Proteasome maturation (1)
- Protected cultivation (1)
- Protein complex analysis (1)
- Protein-protein interaction (1)
- Proton-Transfer-Reaction Mass Spectrometry (1)
- Prunus avium L. (1)
- Präkeramische Papiere (1)
- Prüfungsvorbereitung (1)
- Ps. fluorescens (1)
- Pulping (1)
- Purinergic signaling (1)
- Py-GC/MS (1)
- Py-MS (1)
- Pyrogallol (1)
- Pyroglutamic aciduria (1)
- Pyrolyse-GC/MS (1)
- Pyrolysis GC/MS (1)
- Pyrolysis mass spectrometry (PyMS) (1)
- Pyrolysis-GC/FID (1)
- Pyrolysis-GC/MS (1)
- Pyrolysis-evolved gas analysis-mass spectrometry (1)
- Pyrolysis–GC/MS (1)
- Qualitative Analysis (1)
- Qualitative analysis (1)
- Quantification (1)
- Quasi equilibrium conditions (1)
- R751L (1)
- Radiation (1)
- Raman (1)
- Raman Spectroscopy (1)
- Raman and FTIR spectroscopies (1)
- Raman-Spektroskopie (1)
- Rapeseed pomace (1)
- Rapid method (1)
- Real-time measurement (1)
- Receptors, Purinergic P2 (1)
- Receptors, Purinergic/genetics/physiology (1)
- Redox potential (1)
- Regeneration (1)
- Research reproducibility and replicability (1)
- Resin based composite (1)
- Resin composite (1)
- Resin-based composites (1)
- Resource Planning (1)
- Ressource (1)
- Restorative composite (1)
- Reversible inhibition (1)
- RheoTack analysis (1)
- Rheologie (1)
- Rheology (1)
- Rheometer (1)
- Rosskastanie (1)
- Rubbers (1)
- S-sulfocysteine (1)
- SAM486A (1)
- SARS-COV-2 virus (1)
- SAXS (1)
- SCNN1D (1)
- SEC (1)
- SGN-35 (1)
- SHAP (1)
- SLC6 (1)
- SLC6A14 (1)
- SMBG (1)
- SNPSTR (1)
- SOS-LC (1)
- SOS-LUX test (1)
- SPME (1)
- STARLIFE project (1)
- STF-31 (1)
- Saccharomyces cerevisiae (1)
- Safety and security (1)
- Sample digestion (1)
- Saponin (1)
- Scanning electron microscopy (SEM) (1)
- Schadensanalyse (1)
- Schmauchspur (1)
- Schneeglöckchen (1)
- Schusswaffe (1)
- Schwindung (1)
- Sclera (1)
- Second-Year Undergraduate (1)
- Secondary compounds in plants (1)
- Secondary metabolism (1)
- Selektives Screening (1)
- Selenocysteine (1)
- Self-assembling (1)
- Sensorik (1)
- Sensors (1)
- Serine (1)
- Serine proteases (1)
- Sexual assault (1)
- Shear thickening (1)
- Shear viscosity (1)
- Sicherheitsmaßnahme (1)
- Silica gel (1)
- Silica-based nanobeads (1)
- Silicon Carbides (1)
- Silphium (1)
- Silphium perfoliatum (1)
- Simulated sunlight (1)
- Sinapine (1)
- Single Lens Reflex Camera (1)
- Single sperm cells (1)
- Skin (1)
- Skin cells (1)
- Skin flakes (1)
- Soluble CD21 (1)
- Soluble CD23 (1)
- Solution chemistry (1)
- Space (1)
- Space radiation (1)
- Spectroscropy (1)
- Sperm cells (1)
- Spermatozoa (1)
- Splicing (1)
- Spoilage (1)
- Spoilage bacteria (1)
- Sports doping (1)
- Sprengstoffspürhund (1)
- Sprouting (1)
- Spürhund (1)
- Stabilisator (1)
- Stabilization (1)
- Stabilizer (1)
- Stammzelle (1)
- Static stiffness (1)
- Statik (1)
- Statistical methods (1)
- Steinzeug (1)
- Stem cell (1)
- Stem cell differentiation (1)
- Stereoisomers (1)
- Steroidal saponin (1)
- Stiffness (1)
- Storage modulus (1)
- Store-operated calcium entry (1)
- Strain stiffening (1)
- Stress analysis (1)
- Stress strain relation (1)
- Strukturaufklärung (1)
- Studienfach (1)
- Study Island (1)
- Stöchiometrie (1)
- Substrate mapping (1)
- Substrate specificity (1)
- Sulfite oxidase (1)
- Sulfonamides (1)
- Superconductivity (1)
- Supervised classification (1)
- Support vector machines (1)
- Surfaces, interfaces and thin films (1)
- Surveillance (1)
- Survey (1)
- Suspension (1)
- Sympathetic reflexes (1)
- Synergie (1)
- Synovial fluid (1)
- Synthesis (1)
- Systemic lupus erythomatosus (SLE) (1)
- TATP (1)
- TGA-FTIR (1)
- TGA-MS (1)
- TOF (1)
- Tandem-Massenspektrometrie (1)
- Tap water (1)
- Targeted mass spectrometry (1)
- Technische Chemie (1)
- Telemedicine (1)
- Telogen hair (1)
- Temperaturgradienten (1)
- Template-mediation (1)
- Terbium(III) dipicolinic acid complex (1)
- Tetramerisation (1)
- Therapeutic antibodies* (1)
- Thermal barrier coating (1)
- Thermal conductivity (1)
- Thermal expansion (1)
- Thermochemical conversion (1)
- Thermodynamics (1)
- Thermoplastic polyurethanes (1)
- Thermormechanical fatigue/cycling (1)
- Thermoschockverhalten (1)
- Thiol antioxidants (1)
- TiO2-coatings (1)
- Time dependency (1)
- Time–kill methodology (1)
- Tinten (1)
- Tissue-specific promoters (1)
- Total phenol content (1)
- Transcription Regulation (1)
- Transcriptional targeting (1)
- Transdermal therapeutic system (1)
- Transformation products (1)
- Transgenic mice (1)
- Trapped radicals (1)
- Treatment (1)
- Truncated dhs (1)
- Type 2 diabetes (1)
- UPR signaling (1)
- UV Absorption (1)
- UV absorbance (1)
- UV spectrum (1)
- UV-Absorption (1)
- UV-VIS (1)
- UV-vis spectroscopy (1)
- Ultimate coefficient of thermal expansion (1)
- Ultrafine microstructures (1)
- Ultrasonic studies (1)
- Unconjugated THC-COOH (1)
- Urea cycle defect (1)
- Urinary bladder (1)
- Urinary organic acids (1)
- Urine organic acid analysis (1)
- Urothione (1)
- Used engine oil (1)
- VOCs (1)
- Valproic acid (1)
- Vascular Smooth Muscle Cells (1)
- Vascular cells (1)
- Vascular grafts (1)
- Vascular permeability (1)
- Vasculature (1)
- Verzug (1)
- Vibrational microspectroscopy (1)
- Vickers hardness (1)
- Vim3 (1)
- Visceral afferents (1)
- Visceral lipid tissue (1)
- Visceral pain (1)
- Viscoelastic behavior (1)
- Visible light curing (1)
- Visible light curing resin (1)
- Visible light-curing (1)
- Vitamin A acetate isomers (1)
- Volatile organic compounds (1)
- Vulkanisation (1)
- WAXS (1)
- WZB117 (1)
- Wasserverteilung (1)
- Weihnachtsbaum (1)
- Werkstoffmodellierung (1)
- Western blot (1)
- Whole genome amplification (WGA) (1)
- Whole-genome sequencing (1)
- Wild Type Mouse (1)
- Wildlife Forensics (1)
- Wireless sensor network (1)
- Wirkstofffreisetzung (1)
- Wnt/β-catenin (1)
- Wolframin (1)
- Wärmedämmschicht (1)
- X Thermal barrier coating (1)
- X-STR (1)
- X-ray photoelectron spectroscopy (1)
- X-ray powder diffraction (XRD) (1)
- XBP1 (1)
- XGBoost (1)
- XRD (1)
- Y-STR (1)
- Yeast (1)
- Yield stress (1)
- Young’s modulus (1)
- Zahnfollikel (1)
- Zahnfüllung (1)
- Zytokin-induzierte Killerzellen (1)
- accelerated iron ions (1)
- accurate monitoring (1)
- acetoacetic acid (1)
- acetone (1)
- acidic ethanosolv (1)
- actin (1)
- actinometry (1)
- adhesion factor (1)
- adoptive cell transfer (1)
- adverse effects (1)
- aerogels (1)
- agarose (1)
- aircraft engine part (1)
- albuminuria (1)
- alkaline phosphatase (1)
- alkyl amines (1)
- allergenicity (1)
- allosteric communication (1)
- altered mitochondrial homeostasis (1)
- amelogenesis (1)
- amino acid transporter (1)
- amodiaquine (1)
- amorphous 2D polymer (1)
- amplicon sequencing (1)
- anabolic (1)
- anaplastic lymphoma kinase (1)
- angiodiabetes (1)
- anorganische Schmauchspur (1)
- antibacterial (1)
- antibiotic prophylaxis (1)
- antibody–drug conjugate (1)
- antifungal (1)
- antimicrobial (1)
- antimicrobial coatings (1)
- antimikrobielle Beschichtungen (1)
- antioxidative capacity (1)
- antiradical activity (1)
- apple allergy (1)
- apple replant disease (ARD) (1)
- arthritis (1)
- ash (1)
- astrobiology (1)
- atmosphere (1)
- autism spectrum disorders (1)
- autohydrolysis (1)
- autoimmune disease (1)
- autologous bone graft (1)
- automated electrophysiology (1)
- automated sensor-screening (1)
- automatic measurement validation (1)
- automation of sample processing (1)
- automotive paint (1)
- automotive lever (1)
- autophagy signaling pathways (1)
- bagasse (1)
- basalt (1)
- bdelloid rotifer (1)
- beaching (1)
- behavior and cognition (1)
- benchtop (1)
- benzoyl-coA (1)
- beta-ketothiolase (1)
- bio-based (1)
- bio-chemicals (1)
- bio-innovation (1)
- bioactive factors (1)
- biobased plastics (1)
- biobasiert (1)
- biobasierte Kunststoffe (1)
- biochemical fingerprinting (1)
- biochemistry (1)
- biocomposite (1)
- biodegradable (1)
- bioenergy (1)
- biofilm removal (1)
- biofilm-related infections (1)
- bioinformatics (1)
- biomarker (1)
- biomarker profile (1)
- biomaterials (1)
- biomolecules (1)
- biopolymer (1)
- biopolymers (1)
- biorefineries (1)
- bio‐based (1)
- black fungi (1)
- blebbistatin (1)
- blood glucose meters (1)
- blood glucose monitoring device (1)
- blood vessel (1)
- blow molding (1)
- blown film (1)
- bone mineral density (1)
- bone remodeling (1)
- brain tumor (1)
- branched-chain amino acids (1)
- breast carcinoma (1)
- brightfield microscopy (1)
- brilliant green (1)
- built environment (1)
- bulk and local viscoelastic properties (1)
- bypass graft (1)
- cPMP (1)
- cabbage waste (1)
- calendering (1)
- cancer (1)
- cancer biomarker (1)
- cancer treatment (1)
- cannabidiol, immunotherapy (1)
- cardiodiabetes (1)
- cardiovascular replacement (1)
- cartilage (1)
- caspase (1)
- caspases (1)
- catabolic (1)
- catalysis (1)
- cell division (1)
- cell harvesting (1)
- cell viability (1)
- cellulose saccharification (1)
- cementogenesis (1)
- ceramic (1)
- ceramics (1)
- chaetocin (1)
- chain extender cross-linker (1)
- chain extenders cross-linker (1)
- chain extending cross-linker (1)
- chain-extending cross-linker (1)
- characterization (1)
- chemical pathology (1)
- chemosensing (1)
- chiral-nematic (1)
- chitosan (1)
- cholesteric liquid crystals (1)
- cholesteric phase (1)
- chromanones (1)
- chromatogram library (1)
- ciclopirox olamine (1)
- clear cell renal cell carcinoma (1)
- clear coat (1)
- clinical trials (1)
- coagulation (1)
- coaxial electrospinning (1)
- coefficient of thermal expansion (1)
- coffee ring effect (1)
- collagen (1)
- combination (1)
- combination of treatments (1)
- common variable immunodeficiency (1)
- components (1)
- composite materials (1)
- composites (1)
- compost disintegration (1)
- condensation (1)
- conditioned media (1)
- confocal fluorescence microscopy (1)
- contribution ratio (1)
- copolymers of methacrylic acid with poly(ethylene glycol) methyl ether methacrylate macromonomers (1)
- core-sheath fibers (1)
- cosmic rays (1)
- cost optimization (1)
- cracks (1)
- creep compliance (1)
- cross-linking (1)
- crystal violet (1)
- crystallinity (1)
- cube in cube model (1)
- curing behavior (1)
- cysticfibrosis (1)
- cytoskeleton (1)
- data base search (1)
- data evaluation (1)
- decay classes (1)
- defects (1)
- deformation behavior (1)
- degraded DNA (1)
- degree of disintegration (1)
- delta-subunit (1)
- demethylation (1)
- dental implant (1)
- dental polymers (1)
- dental stem cells (1)
- dental stem cells immortalization (1)
- dentinogenesis (1)
- dentogenesis (1)
- dependability analysis (1)
- depolymerization (1)
- desert cyanobacteria (1)
- designer drugs (1)
- detaching (1)
- determination of OH content (1)
- diabetes mellitus (1)
- diabetic dyslipidemia (1)
- diagnosis and management (1)
- dielectric analysis (DEA) (1)
- dielektrická analýza (1)
- differential scanning calorimetry (DSC) (1)
- disintegration kinetics (1)
- dissolved ozone (1)
- distribuce záření (1)
- distributed embedded computing system (1)
- draw ratio (1)
- drug delivery (1)
- drug detection (1)
- drug release materials (1)
- duty ratio (1)
- dyes (1)
- dynamic mechanic analysis (DMA) (1)
- eIF-5A (1)
- electroless copper deposition (1)
- electroretinography (1)
- electrospinning (1)
- elementary volume (1)
- encapsulation (1)
- endocytosis (1)
- endometrial carcinoma (1)
- endoplasmic reticulum (ER) stress (1)
- endoplasmic reticulum stress (1)
- endothelial cell (1)
- endothelial cell differentiation (1)
- endothelial cells (1)
- energy deposition (1)
- energy dispersive X-ray diffraction (1)
- engineering plastics (1)
- enzyme activity (1)
- epithelial sodium channel (1)
- epithelial transport (1)
- epitope mapping (1)
- ethacrynic acid (1)
- exon fusion (1)
- explosives (1)
- explosives detection (1)
- extra column band broadening (1)
- extraction-linked bias (1)
- failure analysis (1)
- fasentin (1)
- fatty acid metabolism (1)
- feature (1)
- fiber composites (1)
- fish gill (1)
- flow cytometry (1)
- flow direction (1)
- fluorinated salts (1)
- food contact material (1)
- food safety (1)
- force-retraction displacement-curve (1)
- forensic (1)
- forensic genetics (1)
- formulation (1)
- fotokompozit (1)
- fractional activity (1)
- fungal and bacterial amplicon sequencing (1)
- gas turbine blade (1)
- gene expression (1)
- generative manufacturing (1)
- genetic polymorphism (1)
- genomic data (1)
- genotype (1)
- geopolymer (1)
- geopolymer foam (1)
- glass fibers (1)
- glucocheck (1)
- glucose uptake inhibitor (1)
- glutamine N-phenylacetyltransferase (1)
- glycemic control (1)
- glycerol (1)
- greenhouse bio-test (1)
- growth factors (1)
- growth hormone (1)
- guidelines (1)
- habitability (1)
- halogen bonding (1)
- hard and soft tissue (1)
- hardness testing (1)
- harvest prediction (1)
- healthcare-associated infections (HAI) (1)
- heart protection (1)
- heat shock proteins (1)
- heat shock response (1)
- heat-transfer method (1)
- heavy ion particle (HZE) radations (1)
- helical drilling (1)
- helical twisting power (1)
- hepatocellular carcinoma (1)
- heterocyclic (1)
- heterozygous ALPL mutation (1)
- high diagnostic coverage and reliability (1)
- high dynamic range resistance readout (1)
- high-performance liquid chromatography (1)
- high-sensitivity C-reactive protein (hsCRP) (1)
- high-throughput DNA sequencing (1)
- high-throughput qRT-PCR (1)
- high-throughput sequencing (1)
- histamine receptor (1)
- histamine receptor antagonist (1)
- histidine decarboxylase (1)
- histone deacetylase inhibitors (1)
- homemade explosives (1)
- homeostatic model assessment (HOMA) (1)
- horse chestnut (1)
- hospital environment (1)
- hospital-acquired infections (1)
- human cholinesterases (1)
- human microbiome (1)
- hydrogen bonding (1)
- hydroxyapatite (1)
- hydroxypropylmethylcellulose (1)
- hyperammonemia (1)
- hypertension (1)
- hypogammaglobulinemia (1)
- hypoglycemia (1)
- hypophosphatasia (1)
- hypoxia (1)
- iPS cells (1)
- iPSCs (1)
- iPad (1)
- immune checkpoint inhibition programmed cell death-1 (1)
- immunhistochemistry (1)
- immunology (1)
- impact monitoring (1)
- impact sensitivity (1)
- impedance spectroscopy (1)
- impregnation-reduction (1)
- increments of retention indices (1)
- individualized therapy (1)
- infection prevention (1)
- infectious disease (1)
- infrared spectroscopy (1)
- inherited metabolic disease (1)
- inorganic pyrophosphate (1)
- intact proinsulin (1)
- integrative Simulation (1)
- integrative simulation (1)
- interferon γ (1)
- internal drug exposure (1)
- intrinsic pathway (1)
- invasion (1)
- ion viscosity (1)
- ionic polymer metal (1)
- isoleucine metabolism (1)
- isothermal (1)
- ketogenesis defects (1)
- ketogenez defektleri (1)
- ketoliz defektleri (1)
- ketolysis defects (1)
- keton bodies (1)
- ketone body synthesis (1)
- kinetika vytvrzování (1)
- klarzelliges Nierenzellkarzinom (1)
- layer-by-layer encapsulation (1)
- leishmaniasis (1)
- leucine degradation (1)
- life on Mars (1)
- life-detection (1)
- light distribution (1)
- lignin structure analysis (1)
- lignocellulose chemistry (1)
- lignocellulosic feedstock (1)
- lignocellulosic raw material (1)
- lignosulfonate (1)
- liquid chromatography (1)
- liquid crystal (1)
- liquid crystals (1)
- long interspersed nuclear element-1 (1)
- long-term storage (1)
- low detection limits (1)
- low molecular weight (1)
- low-level laser therapy (1)
- lung cancer (1)
- lymphoma (1)
- mTOR (1)
- major histocompatibility complex class I polypeptide-related sequence A (MICA) (1)
- massive parallel sequencing (1)
- material modelling (1)
- materials processing (1)
- maturity index (1)
- mechanical testing (1)
- mechanical thinning (1)
- melt fraction (1)
- melt interconnection (1)
- member D (NKG2D) (1)
- mesenchymal stem cell (1)
- mesogens (1)
- metabolic effects (1)
- metabolically active cells (1)
- metal nanoparticles (1)
- metal-oxide-semiconductor gas sensors (1)
- methylmalonic acidaemia (1)
- methylmalonic acidemia (1)
- miR-15 (1)
- miR-498 (1)
- micro processing (1)
- microbial community structure (1)
- microbial contamination (1)
- microbial ecology (1)
- microbiome (1)
- microbiome analyses (1)
- microdialysis (1)
- microindentation (1)
- micromanipulation (1)
- microplastic (1)
- microsatellite instability (1)
- mitochondrial biogenesis (1)
- mixed-mode chromatography (1)
- mobile Explosivstoffdetektion (1)
- modelling (1)
- mold temperature (1)
- molecular docking (1)
- molecular dynamics (1)
- molecular dynamics simulations (1)
- molecular mass degradation (1)
- molecular motor (1)
- molecular pathology (1)
- molecular weight (1)
- molecular weight determination (1)
- molecule-surface interactions (1)
- monoamine oxidases (1)
- monoclonal antibody (1)
- mouse model (1)
- multi-drug response (1)
- multiaxial stress state (1)
- multidimensional (1)
- multineurotarget agents (1)
- multiple myeloma (1)
- multiple myeloma (MM) (1)
- multiresolution analysis (1)
- multivariate data analysis (1)
- multivariate statistical analysis (1)
- multivariate statistics (1)
- mutations (1)
- myogenesis (1)
- nachhaltig (1)
- nano structured gas sensors (1)
- nanobodies (1)
- nanocrystalline diamond (1)
- nanomaterials (1)
- nanomedicine (1)
- nanostructured surfaces (1)
- natural fiber (1)
- natural killer group 2 (1)
- neoexpression (1)
- neuroendocrine (1)
- next generation sequencing (1)
- nitrogen dioxide (1)
- non-HDL-C and Cardiovascular disease (1)
- non-apoptotic roles (1)
- non-small cell lung cancer (1)
- non-woven fiber mats (1)
- nondestructive examination (1)
- nosocomial infections (1)
- nucleic acids (1)
- nutrient germinants (1)
- nutrigenetics (1)
- nutrigenomics (1)
- odontogenic cells (1)
- operando Raman spectroscopies (1)
- organic acid analysis (1)
- organische Schmauchspur (1)
- organoids (1)
- organosolv lignin (1)
- orthotropes prozessabhängiges Materialverhalten (1)
- orthotropic process-dependent material behavior (1)
- osteogenic potential (1)
- osteoporosis (1)
- outer space (1)
- oxalic acid (1)
- p27 (1)
- p53 (1)
- paediatric clinical genetics & dysmorphology (1)
- paediatric endocrinology (1)
- paediatric intensive & critical care (1)
- panspermia (1)
- papier-abgeleitete Keramiken (1)
- papierabgeleitete Keramik (1)
- partial melting (1)
- partial squares regression (1)
- particle processing (1)
- particulate composite (1)
- patent (1)
- pathogen control (1)
- pathogenic microorganisms (1)
- pathophysiology (1)
- peptide sequencing (1)
- perpendicular (1)
- personalized medicine (1)
- pharmacokinetics (1)
- phase II reaction (1)
- phenylacetyl-coA (1)
- phenylketonuria (1)
- phosphoethanolamine (1)
- photo-curing of polymers (1)
- photo-polymerization (1)
- photocatalysis (1)
- photostabiliser (1)
- phytoalexins (1)
- pigments (1)
- planetary protection (1)
- plastic pollution (1)
- poly(butylene adipate-co-terephthalate) (1)
- poly(ethylene glycol) methyl ether methacrylate macromonomers (1)
- polybutylene adipate terephthalate (1)
- polyelectrolytes (1)
- polylactic acid (1)
- polysaccharide (1)
- polytunnel (1)
- polyurethane coatings (1)
- porosity (1)
- porphyria (1)
- postmenopause (1)
- potentiometric sensors (1)
- power industry (1)
- power stroke (1)
- precision (1)
- pressure sensitive adhesive (1)
- primary airway epithelial cells (1)
- primates (1)
- primäre Explosivstoffe (1)
- principal component analysis (1)
- prioritizable ranking (1)
- proanthocyanidins (1)
- probiotic cleaning (1)
- probiotic-based cleaning formulations (1)
- process parameters (1)
- process-induced morphology (1)
- process-induced structure (1)
- processing-structure-property relationship (1)
- project-specific cost profile (1)
- proliferation (1)
- propionic acidaemia (1)
- propionic acidemia (1)
- protected cultivation (1)
- protein microarray (1)
- proteomics (1)
- prototype apparatus (1)
- proximal tubule (1)
- präkeramisches Papier (1)
- pseudogene (1)
- purinergic receptor (1)
- purinergic receptors (1)
- pyridoxal phosphate (1)
- pyrolysis-GC (1)
- pyrolysis-gas chromatography/mass-spectrometry (1)
- pyroplastic deformation (1)
- pyroplastic index (1)
- pyroplastische Verformung (1)
- pyroplastischer Index (1)
- qNMR (1)
- qPCR (1)
- quantitative RP-HPLC-DAD (1)
- quantitative RT-PCR (1)
- radiation (1)
- radioresistance (1)
- rating method (1)
- real-time PCR (1)
- recurrent ketoacidotic episodes (1)
- redundancy (1)
- regenerative medicine (1)
- relative density (1)
- release kinetics (1)
- renal cancer (1)
- renal cell carcinoma (1)
- renal tubular cells (1)
- resin for 3D-printing (1)
- resistance (1)
- ressources (1)
- restenosis (1)
- retinal degeneration (1)
- retraction speed dependency (1)
- rheumatoid arthritis (1)
- ring-size statistics (1)
- ripening (1)
- rodent (1)
- rodents (1)
- rosiglitazone (1)
- rubbers (1)
- sCD21 (1)
- safety measures (1)
- scanning tunnelling microscopy (1)
- scratch assay (1)
- screening (1)
- seed coat (1)
- selectivity tuning (1)
- self-assembled monolayers (1)
- self-monitoring BG (1)
- semiconducting metal oxide gas sensor array (1)
- semiconductors (1)
- sensitize (1)
- sensor array (1)
- sensory characterisation (1)
- sequencing (1)
- sexual assault (1)
- short tandem repeat (1)
- short tandem repeat (STR) (1)
- short-range correlation (1)
- shrinkage (1)
- single-domain antibody (1)
- single-nucleotide polymorphisms in DNA (1)
- sintering (1)
- sirtuins (1)
- size exclusion chromatography (1)
- skin cancer (1)
- slope based signature (1)
- smooth muscle cell (1)
- smooth muscle cell differentiation (1)
- snowdrop (1)
- sodium alginate (1)
- sodium self-inhibition (1)
- soil properties (1)
- soil sickness (1)
- sol-gel support (1)
- solute carrier (1)
- solvent exchange (1)
- space radiation environment (1)
- sperm cell (1)
- spore resistance (1)
- sporegermination (1)
- stabilisation (1)
- stabiliser (1)
- stationary phase (1)
- staurosporine (1)
- steady-state concentration (1)
- stem cell niche (1)
- stent (1)
- stoneware (1)
- stress analysis (1)
- structural biology (1)
- structural coloration (1)
- structure elucidation (1)
- structure prediction (1)
- substance aging (1)
- superalloys (1)
- supercritical drying (1)
- superficially porous particles (1)
- supramolecular liquid crystals (1)
- surface modification (1)
- surface sanitization (1)
- surfaces (1)
- surrogate endpoint (1)
- survival (1)
- sustainable (1)
- sweet cherry (Prunus avium L.) (1)
- sweet sorghum (1)
- switchgear station (1)
- synergism (1)
- synergistic effect (1)
- synthetic sapphire (1)
- system lay-out (1)
- system optimization (1)
- systemic response (1)
- tRNA processing (1)
- tack (1)
- temperature influence (1)
- templates (1)
- temporomandibular joint (1)
- therapy (1)
- thermal barrier coating (1)
- thermal gradient (1)
- thermal insulation material (1)
- thermal insulation materials (1)
- thermal shock behaviour (1)
- thermo-mechanical fatigue (1)
- thermochemical conversion (1)
- thermogravimetric analysis (1)
- thermomechanical fatigue/cycling (1)
- thermomechanische Ermüdung (1)
- thermophoresis (1)
- thermosensing (1)
- thin film (1)
- tiglyglycine (1)
- time series analysis (1)
- total phenolic content (1)
- transcriptional regulation (1)
- transient kinetics (1)
- transient receptor potential vanilloid Type 2 (1)
- triacetone triperoxide (1)
- triacetone triperoxides (1)
- triiodothyronine (1)
- triphenylmethane dyes (1)
- tumor diagnosis (1)
- tunable pitch (1)
- tunable sheet resistance (1)
- tungsten oxide (1)
- tungsten oxides (1)
- tvrdost (1)
- two-electrode voltage clamp (1)
- ultrashort pulse laser (1)
- unfolded protein response (1)
- unfolded protein response (UPR) (1)
- urea cycle defect (1)
- valine catabolic pathway (1)
- valine degradation (1)
- van Deemter curve (1)
- viscoelastic properties (1)
- visible light curing resin based composites (1)
- viskoelastické vlastnosti (1)
- volatile organic compound (VOC) sensing (1)
- volatile organic compounds (1)
- vytvrzování světlem (1)
- warpage (1)
- water-to-land transition (1)
- wearable technology (1)
- whole genome amplification (WGA) (1)
- whole-tooth regeneration (1)
- woody debris (1)
- wound healing assay (1)
- yield (1)
- yin-yang effect (1)
- zona pellucida protein 2 ZP2 (1)
- µCT (1)
- ß-OHB (1)
- ß-hydroxybutyrate (1)
- β-amino acids (1)
- β-catenin (1)
- β-catenin expression (1)
- β-cell dysfunction (1)
- β-cells (1)
- γ-glutamyl cycle (1)
- σ1 and σ2 receptors (1)
Jet engines of airplanes are designed such that in some components damage occurs and accumulates in service without being critical up to a certain level of damage. Since maintenance, repair, and component exchange are very cost-intensive, it is necessary to predict efficiently the component lifetime with high accuracy. A former developed lifetime model, based on interpolated results of aerodynamic and structural mechanics simulations, uses material parameters estimated from literature values of standard creep experiments. For improved accuracy, an experimental procedure is developed for the characterization of the short-time creep behavior, which is relevant for the operation of turbine blades of jet engines. To consider microstructural influences resulting from the manufacturing of thin-walled single crystal turbine blades, small-scale specimens from used turbine blades are extracted and tested in short- and medium-time creep experiments. Based on experimental results and literature values, a creep model, which describes the fracture behavior for a wide range of creep loads, is calibrated and is now used for the lifetime prediction of turbine blades under real loading conditions.
Simultaneous determination of selected catechins and pyrogallol in deer intoxications by HPLC-MS/MS
(2021)
BonaRes (Modul A): Überwindung der Bodenmüdigkeit mithilfe eines integrierten Ansatzes - ORDIAmur
(2019)
Brentuximab vedotin (SGN-35) is an antibody–drug conjugate with a high selectivity against CD30+ cell lines and more than 300-fold less activity against antigen-negative cells. In the last years, the results of many in vitro and in vivo studies have led to the fast approval of this drug to treat lymphoma patients. Another innovative method to treat tumor cells including lymphoma cells is the use cytokine-induced killer (CIK) cells, which have also been approved and proven to be a safe treatment with only minor adverse events. In this study, a possible additive effect when combining SGN-35 with CIK cells was investigated. The combinational treatment showed that it reduces the viability of CD30+ cell lines significantly in vitro. Additionally, the amount of lymphoma cells was significantly reduced when exposed to CIK cells as well as when exposed to SGN-35. A significant negative effect of SGN-35 on the function of CIK cells could be excluded. These results lead to the assumption that SGN-35 and CIK cells in combination might achieve better results in an in vitro setting compared to the single use of SGN-35 and CIK cells. Further investigations in in vivo models must be conducted to obtain a better understanding of the exact mechanisms of both treatments when applied in combination.
The motor protein myosin drives a wide range of cellular and muscular functions by generating directed movement and force, fueled through adenosine triphosphate (ATP) hydrolysis. Release of the hydrolysis product adenosine diphosphate (ADP) is a fundamental and regulatory process during force production. However, details about the molecular mechanism accompanying ADP release are scarce due to the lack of representative structures. Here we solved a novel blebbistatin-bound myosin conformation with critical structural elements in positions between the myosin pre-power stroke and rigor states. ADP in this structure is repositioned towards the surface by the phosphate-sensing P-loop, and stabilized in a partially unbound conformation via a salt-bridge between Arg131 and Glu187. A 5 Å rotation separates the mechanical converter in this conformation from the rigor position. The crystallized myosin structure thus resembles a conformation towards the end of the two-step power stroke, associated with ADP release. Computationally reconstructing ADP release from myosin by means of molecular dynamics simulations further supported the existence of an equivalent conformation along the power stroke that shows the same major characteristics in the myosin motor domain as the resolved blebbistatin-bound myosin-II·ADP crystal structure, and identified a communication hub centered on Arg232 that mediates chemomechanical energy transduction.
Cyanobacteria are gaining considerable interest as a method of supporting the long-term presence of humans on the Moon and settlements on Mars due to their ability to produce oxygen and their potential as bio-factories for space biotechnology/synthetic biology and other applications. Since many unknowns remain in our knowledge to bridge the gap and move cyanobacterial bioprocesses from Earth to space, we investigated cell division resumption on the rehydration of dried Chroococcidiopsis sp. CCMEE 029 accumulated DNA damage while exposed to space vacuum, Mars-like conditions, and Fe-ion radiation. Upon rehydration, the monitoring of the ftsZ gene showed that cell division was arrested until DNA damage was repaired, which took 48 h under laboratory conditions. During the recovery, a progressive DNA repair lasting 48 h of rehydration was revealed by PCR-stop assay. This was followed by overexpression of the ftsZ gene, ranging from 7.5- to 9-fold compared to the non-hydrated samples. Knowing the time required for DNA repair and cell division resumption is mandatory for deep-space experiments that are designed to unravel the effects of reduced/microgravity on this process. It is also necessary to meet mission requirements for dried-sample implementation and real-time monitoring upon recovery. Future experiments as part of the lunar exploration mission Artemis and the lunar gateway station will undoubtedly help to move cyanobacterial bioprocesses beyond low Earth orbit. From an astrobiological perspective, these experiments will further our understanding of microbial responses to deep-space conditions.
While many proteins are known clients of heat shock protein 90 (Hsp90), it is unclear whether the transcription factor, thyroid hormone receptor beta (TRb), interacts with Hsp90 to control hormonal perception and signaling. Higher Hsp90 expression in mouse fibroblasts was elicited by the addition of triiodothyronine (T3). T3 bound to Hsp90 and enhanced adenosine triphosphate (ATP) binding of Hsp90 due to a specific binding site for T3, as identified by molecular docking experiments. The binding of TRb to Hsp90 was prevented by T3 or by the thyroid mimetic sobetirome. Purified recombinant TRb trapped Hsp90 from cell lysate or purified Hsp90 in pull-down experiments. The affinity of Hsp90 for TRb was 124 nM. Furthermore, T3 induced the release of bound TRb from Hsp90, which was shown by streptavidin-conjugated quantum dot (SAv-QD) masking assay. The data indicate that the T3 interaction with TRb and Hsp90 may be an amplifier of the cellular stress response by blocking Hsp90 activity.
Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC50 of 50 μM. The binding motif can influence the activity of Hsp90 by hindering ATP accessibility or the release of ADP.
Isolated methylmalonic acidaemia (MMA) and propionic acidaemia (PA) are rare inherited metabolic diseases. Six years ago, a detailed evaluation of the available evidence on diagnosis and management of these disorders has been published for the first time. The article received considerable attention, illustrating the importance of an expert panel to evaluate and compile recommendations to guide rare disease patient care. Since that time, a growing body of evidence on transplant outcomes in MMA and PA patients and use of precursor free amino acid mixtures allows for updates of the guidelines. In this article, we aim to incorporate this newly published knowledge and provide a revised version of the guidelines. The analysis was performed by a panel of multidisciplinary health care experts, who followed an updated guideline development methodology (GRADE). Hence, the full body of evidence up until autumn 2019 was re‐evaluated, analysed and graded. As a result, 21 updated recommendations were compiled in a more concise paper with a focus on the existing evidence to enable well‐informed decisions in the context of MMA and PA patient care.
Fixed-dose combination of pioglitazone and glimepiride in the treatment of Type 2 diabetes mellitus
(2007)
The actomyosin system generates mechanical work with the execution of the power stroke, an ATP-driven, two-step rotational swing of the myosin-neck that occurs post ATP hydrolysis during the transition from weakly to strongly actin-bound myosin states concomitant with Pi release and prior to ADP dissociation. The activating role of actin on product release and force generation is well documented; however, the communication paths associated with weak-to-strong transitions are poorly characterized. With the aid of mutant analyses based on kinetic investigations and simulations, we identified the W-helix as an important hub coupling the structural changes of switch elements during ATP hydrolysis to temporally controlled interactions with actin that are passed to the central transducer and converter. Disturbing the W-helix/transducer pathway increased actin-activated ATP turnover and reduced motor performance as a consequence of prolonged duration of the strongly actin-attached states. Actin-triggered Pi release was accelerated, while ADP release considerably decelerated, both limiting maximum ATPase, thus transforming myosin-2 into a high-duty-ratio motor. This kinetic signature of the mutant allowed us to define the fractional occupancies of intermediate states during the ATPase cycle providing evidence that myosin populates a cleft-closure state of strong actin interaction during the weak-to-strong transition with bound hydrolysis products before accomplishing the power stroke.
The genetic basis of brain tumor development is poorly understood. Here, leukocyte DNA of 21 patients from 15 families with ≥ 2 glioma cases each was analyzed by whole-genome or targeted sequencing. As a result, we identified two families with rare germline variants, p.(A592T) or p.(A817V), in the E-cadherin gene CDH1 that co-segregate with the tumor phenotype, consisting primarily of oligodendrogliomas, WHO grade II/III, IDH-mutant, 1p/19q-codeleted (ODs). Rare CDH1 variants, previously shown to predispose to gastric and breast cancer, were significantly overrepresented in these glioma families (13.3%) versus controls (1.7%). In 68 individuals from 28 gastric cancer families with pathogenic CDH1 germline variants, brain tumors, including a pituitary adenoma, were observed in three cases (4.4%), a significantly higher prevalence than in the general population (0.2%). Furthermore, rare CDH1 variants were identified in tumor DNA of 6/99 (6%) ODs. CDH1 expression was detected in undifferentiated and differentiating oligodendroglial cells isolated from rat brain. Functional studies using CRISPR/Cas9-mediated knock-in or stably transfected cell models demonstrated that the identified CDH1 germline variants affect cell membrane expression, cell migration and aggregation. E-cadherin ectodomain containing variant p.(A592T) had an increased intramolecular flexibility in a molecular dynamics simulation model. E-cadherin harboring intracellular variant p.(A817V) showed reduced β-catenin binding resulting in increased cytosolic and nuclear β-catenin levels reverted by treatment with the MAPK interacting serine/threonine kinase 1 inhibitor CGP 57380. Our data provide evidence for a role of deactivating CDH1 variants in the risk and tumorigenesis of neuroepithelial and epithelial brain tumors, particularly ODs, possibly via WNT/β-catenin signaling.
Composite nanoparticles (NPs) consisting of lignin and different polysaccharide (PS) derivatives were prepared. In this synergistic approach, the PS derivative acts as biocompatible matrix that forms spherical NPs while lignin is a functional compound with therapeutic potential (e.g., antioxidative, antimicrobial, antiviral). Organosolv lignin and three different PS derivatives (cellulose acetate/CA, cellulose acetate phthalate/CAPh, xylan phenyl carbonate/XPC) were used in this study. Nanocomposites with particle sizes in the range of about 200–550 nm containing both types of biopolymers are accessible by dialysis of organic PS/lignin solutions against water. In particular, XPC and CAPh, which both contain aromatic substituents, were found to be suitable for incorporation of lignin within the PS nanomatrix. The present work paves the way for future studies in which the pharmaceutical potential and biocompatibility of composite NPs of lignin and PS derivatives with tailored properties are investigated.
The epithelial sodium channel (ENaC) plays a key role in salt and water homeostasis in tetrapod vertebrates. There are four ENaC subunits (α, β, γ, δ), forming heterotrimeric αβγ- or δβγ-ENaCs. While the physiology of αβγ-ENaC is well understood, for decades the field has stalled with respect to δβγ-ENaC due to the lack of mammalian model organisms. The SCNN1D gene coding for δ-ENaC was previously believed to be absent in rodents, hindering studies using standard laboratory animals. We analysed all currently available rodent genomes and discovered that SCNN1D is present in rodents but was independently lost in five rodent lineages, including the Muridae (mice and rats). The independent loss of SCNN1D in rodent lineages may be constrained by phylogeny and taxon-specific adaptation to dry habitats, however habitat aridity does not provide a selection pressure for maintenance of SCNN1D across Rodentia. A fusion of two exons coding for a structurally flexible region in the extracellular domain of δ-ENaC appeared in the Hystricognathi (a group that includes guinea pigs). This conserved pattern evolved at least 41 Ma ago and represents a new autapomorphic feature for this clade. Exon fusion does not impair functionality of guinea pig (Cavia porcellus) δβγ-ENaC expressed in Xenopus oocytes. Electrophysiological characterisation at the whole-cell and single-channel level revealed conserved biophysical features and mechanisms controlling guinea pig αβγ- and δβγ-ENaC function as compared to human orthologues. Guinea pigs therefore represent commercially available mammalian model animals that will help shed light on the physiological function of δ-ENaC.
Here we provide the electrophysiology data for the manuscript "Two functional epithelial sodium channel isoforms are present in rodents despite pronounced evolutionary pseudogenization and exon fusion", published in Molecular Biology and Evolution (2021): msab271 (doi: 10.1093/molbev/msab271). Data are reported as current values in Excel format, sorted according to the appearance in Figures and supplemented by explanatory text on the procedures/data presentation.
Exosomes derived from human autologous conditioned serum are nanocarriers for IL-6 and TNF-alfa
(2017)
Nanomedicine strategies were first adapted and successfully translated to clinical application for diseases, such as cancer and diabetes. These strategies would no doubt benefit unmet diseases needs as in the case of leishmaniasis. The latter causes skin sores in the cutaneous form and affects internal organs in the visceral form. Treatment of cutaneous leishmaniasis (CL) aims at accelerating wound healing, reducing scarring and cosmetic morbidity, preventing parasite transmission and relapse. Unfortunately, available treatments show only suboptimal effectiveness and none of them were designed specifically for this disease condition. Tissue regeneration using nano-based devices coupled with drug delivery are currently being used in clinic to address diabetic wounds. Thus, in this review, we analyse the current treatment options and attempt to critically analyse the use of nanomedicine-based strategies to address CL wounds in view of achieving scarless wound healing, targeting secondary bacterial infection and lowering drug toxicity.
Scratch assays enable the study of the migration process of an injured adherent cell layer in vitro. An apparatus for the reproducible performance of scratch assays and cell harvesting has been developed that meets the requirements for reproducibility in tests as well as easy handling. The entirely autoclavable setup is divided into a sample translation and a scratching system. The translational system is compatible with standard culture dishes and can be modified to adapt to different cell culture systems, while the scratching system can be adjusted according to angle, normal force, shape, and material to adapt to specific questions and demanding substrates. As a result, a fully functional prototype can be presented. This system enables the creation of reproducible and clear scratch edges with a low scratch border roughness within a monolayer of cells. Moreover, the apparatus allows the collection of the migrated cells after scratching for further molecular biological investigations without the need for a second processing step. For comparison, the mechanical properties of manually performed scratch assays are evaluated.
Monitoring the content of dissolved ozone in purified water is often mandatory to ensure the appropriate levels of disinfection and sanitization. However, quantification bears challenges as colorimetric assays require laborious off-line analysis, while commercially available instruments for electrochemical process analysis are expensive and often lack the possibility for miniaturization and discretionary installation. In this study, potentiometric ionic polymer metal composite (IPMC) sensors for the determination of dissolved ozone in ultrapure water (UPW) systems are presented. Commercially available polymer electrolyte membranes are treated via an impregnation-reduction method to obtain nanostructured platinum layers. By applying 25 different synthesis conditions, layer thicknesses of 2.2 to 12.6 µm are obtained. Supporting radiographic analyses indicate that the platinum concentration of the impregnation solution has the highest influence on the obtained metal loading. The sensor response behavior is explained by a Langmuir pseudo-isotherm model and allows the quantification of dissolved ozone to trace levels of less than 10 µg L−1. Additional statistical evaluations show that the expected Pt loading and radiographic blackening levels can be predicted with high accuracy and significance (R2adj. > 0.90, p < 10−10) solely from given synthesis conditions.
Operating an ozone-evolving PEM electrolyser in tap water: A case study of water and ion transport
(2022)
While PEM water electrolysis could be a favourable technique for in situ sanitization with ozone, its application is mainly limited to the use of ultrapure water to achieve a sufficient long-time stability. As additional charge carriers influence the occurring transport phenomena, we investigated the impact of different feed water qualities on the performance of a PEM tap water electrolyser for ozone evolution. The permeation of water and the four most abundant cations (Na+, K+, Ca2+, Mg2+) is characterised during stand-by and powered operation at different charge densities to quantify underlying transport mechanisms. Water transport is shown to linearly increase with the applied current (95 ± 2 mmol A−1 h−1) and occurs decoupled from ion permeation. A limitation of ion permeation is given by the transfer of ions in water to the anode/PEM interface. The unstabilized operation of a PEM electrolyser in tap water leads to a pH gradient which promotes the formation of magnesium and calcium carbonates and hydroxides on the cathode surface. The introduction of a novel auxiliary cathode in the anolytic compartment has shown to suppress ion permeation by close to 20%.
The analysis of used engine oils from industrial engines enables the study of engine wear and oil degradation in order to evaluate the necessity of oil changes. As the matrix composition of an engine oil strongly depends on its intended application, meaningful diagnostic oil analyses bear considerable challenges. Owing to the broad spectrum of available oil matrices, we have evaluated the applicability of using an internal standard and/or preceding sample digestion for elemental analysis of used engine oils via inductively coupled plasma optical emission spectroscopy (ICP OES). Elements originating from both wear particles and additives as well as particle size influence could be clearly recognized by their distinct digestion behaviour. While a precise determination of most wear elements can be achieved in oily matrix, the measurement of additives is performed preferably after sample digestion. Considering a dataset of physicochemical parameters and elemental composition for several hundred used engine oils, we have further investigated the feasibility of predicting the identity and overall condition of an unknown combustion engine using the machine learning system XGBoost. A maximum accuracy of 89.6% in predicting the engine type was achieved, a mean error of less than 10% of the observed timeframe in predicting the oil running time and even less than 4% for the total engine running time, based purely on common oil check data. Furthermore, obstacles and possibilities to improve the performance of the machine learning models were analysed and the factors that enabled the prediction were explored with SHapley Additive exPlanation (SHAP). Our results demonstrate that both the identification of an unknown engine as well as a lifetime assessment can be performed for a first estimation of the actual sample without requiring meticulous documentation.
Bone regeneration and replacement is a major focus in regenerative medicine since degenerative diseases and tumor surgery as well as accidents or dangerous recreational behavior is leading to an increasing need for bone reconstruction strategies. Especially for critical size bone defects, tissue engineering with mesenchymal stem cells is extensively studied because these cells are functioning as precursors for osteoblast in vivo. Nevertheless to reproduce the complex interaction of various factors in vitro is not an easy approach and further investigations have to be done. The status quo is summarized. A variety of growth and transcription factors are known to be involved in osteogenesis with bone morphogenetic proteins (BMPs) and the transcription factor Runx2 being the most extensively studied ones. But also PPAR γ and Osterix are generally regarded as the master regulators of osteoblast differentiation. Recently the large family of purinergic receptors has proven to be essential molecules in osteogenesis as well. In addition, scaffolding is needed to create a three-dimensional tissue. Recent developments in scaffold design are summarized, including natural and synthetic materials with or without the use of bioactive molecules constructed to mimic the natural environment. The status quo of scaffold fabrication methods such as 3D nanoprinting and their influence on cell-scaffold interactions is discussed. In this review we summarize the most interesting results and our related work focusing on two joined approaches: 1) the complex interaction of the most promising factors improving or accelerating osteogenic differentiation and ii) the development of scaffold materials with osteoconductive and osteoinductive properties.
Background: 3-hydroxy-3-methylglutaryl-coenzyme A lyase deficiency (HMGCLD) is an autosomal recessive disorder of ketogenesis and leucine degradation due to mutations in HMGCL.
Method: We performed a systematic literature search to identify all published cases. Two hundred eleven patients of whom relevant clinical data were available were included in this analysis. Clinical course, biochemical findings and mutation data are highlighted and discussed. An overview on all published HMGCL variants is provided.
Results: More than 95% of patients presented with acute metabolic decompensation. Most patients manifested within the first year of life, 42.4% already neonatally. Very few individuals remained asymptomatic. The neurologic long-term outcome was favorable with 62.6% of patients showing normal development.
Conclusion: This comprehensive data analysis provides a systematic overview on all published cases with HMGCLD including a list of all known HMGCL mutations.
2-methylacetoacetyl-coenzyme A thiolase (beta-ketothiolase) deficiency: one disease - two pathways
(2020)
Background: 2-methylacetoacetyl-coenzyme A thiolase deficiency (MATD; deficiency of mitochondrial acetoacetyl-coenzyme A thiolase T2/ “beta-ketothiolase”) is an autosomal recessive disorder of ketone body utilization and isoleucine degradation due to mutations in ACAT1.
Methods: We performed a systematic literature search for all available clinical descriptions of patients with MATD. Two hundred forty-four patients were identified and included in this analysis. Clinical course and biochemical data are presented and discussed.
Results: For 89.6% of patients at least one acute metabolic decompensation was reported. Age at first symptoms ranged from 2 days to 8 years (median 12 months). More than 82% of patients presented in the first 2 years of life, while manifestation in the neonatal period was the exception (3.4%). 77.0% (157 of 204 patients) of patients showed normal psychomotor development without neurologic abnormalities. Conclusion: This comprehensive data analysis provides a systematic overview on all cases with MATD identified in the literature. It demonstrates that MATD is a rather benign disorder with often favourable outcome, when compared with many other organic acidurias.
Background 3-hydroxy-3-methylglutaryl-coenzyme A lyase deficiency (HMGCLD) is an autosomal recessive disorder of ketogenesis and leucine degradation due to mutations in HMGCL .
Method We performed a systematic literature search to identify all published cases. 211 patients of whom relevant clinical data were available were included in this analysis. Clinical course, biochemical findings and mutation data are highlighted and discussed. An overview on all published HMGCL variants is provided.
Results More than 95% of patients presented with acute metabolic decompensation. Most patients manifested within the first year of life, 42.4% already neonatally. Very few individuals remained asymptomatic. The neurologic long-term outcome was favorable with 62.6% of patients showing normal development.
Conclusion This comprehensive data analysis provides a systematic overview on all published cases with HMGCLD including a list of all known HMGCL mutations.
2-methylacetoacetyl-coenzyme A thiolase (beta-ketothiolase) deficiency: one disease - two pathways
(2019)
Background: 2-methylacetoacetyl-coenzyme A thiolase deficiency (MATD; deficiency of mitochondrial acetoacetyl-coenzyme A thiolase T2/ “beta-ketothiolase”) is an autosomal recessive disorder of ketone body utilization and isoleucine degradation due to mutations in ACAT1.
Methods: We performed a systematic literature search for all available clinical descriptions of patients with MATD. 244 patients were identified and included in this analysis. Clinical course and biochemical data are presented and discussed.
Results: For 89.6 % of patients at least one acute metabolic decompensation was reported. Age at first symptoms ranged from 2 days to 8 years (median 12 months). More than 82% of patients presented in the first two years of life, while manifestation in the neonatal period was the exception (3.4%). 77.0% (157 of 204 patients) of patients showed normal psychomotor development without neurologic abnormalities.
Conclusion: This comprehensive data analysis provides a systematic overview on all cases with MATD identified in the literature. It demonstrates that MATD is a rather benign disorder with often favourable outcome, when compared with many other organic acidurias.
The development of metals tailored to the metallurgical conditions of laser-based additive manufacturing is crucial to advance the maturity of these materials for their use in structural applications. While efforts in this regard are being carried out around the globe, the use of high strength eutectic alloys have, so far, received minor attention, although previous works showed that rapid solidification techniques can result in ultrafine microstructures with excellent mechanical performance, albeit for small sample sizes. In the present work, a eutectic Ti-32.5Fe alloy has been produced by laser powder bed fusion aiming at exploiting rapid solidification and the capability to produce bulk ultrafine microstructures provided by this processing technique.
Process energy densities between 160 J/mm³ and 180 J/mm³ resulted in a dense and crack-free material with an oxygen content of ~ 0.45 wt.% in which a hierarchical microstructure is formed by µm-sized η-Ti4Fe2Ox dendrites embedded in an ultrafine eutectic β-Ti/TiFe matrix. The microstructure was studied three-dimensionally using near-field synchrotron ptychographic X-ray computed tomography with an actual spatial resolution down to 39 nm to analyse the morphology of the eutectic and dendritic structures as well as to quantify their mass density, size and distribution. Inter-lamellar spacings down to ~ 30–50 nm were achieved, revealing the potential of laser-based additive manufacturing to generate microstructures smaller than those obtained by classical rapid solidification techniques for bulk materials. The alloy was deformed at 600 °C under compressive loading up to a strain of ~ 30% without damage formation, resulting in a compressive yield stress of ~ 800 MPa.
This study provides a first demonstration of the feasibility to produce eutectic Ti-Fe alloys with ultrafine microstructures by laser powder bed fusion that are suitable for structural applications at elevated temperature.
The Potential of Sustainable Antimicrobial Additives for Food Packaging from Native Plants in Benin
(2019)
Bioinspired stem cell-based hard tissue engineering includes numerous aspects: The synthesis and fabrication of appropriate scaffold materials, their analytical characterization, and guided osteogenesis using the sustained release of osteoinducing and/or osteoconducting drugs for mesenchymal stem cell differentiation, growth, and proliferation. Here, the effect of silicon- and silicate-containing materials on osteogenesis at the molecular level has been a particular focus within the last decade. This review summarizes recently published scientific results, including material developments and analysis, with a special focus on silicon hybrid bone composites. First, the sources, bioavailability, and functions of silicon on various tissues are discussed. The second focus is on the effects of calcium-silicate biomineralization and corresponding analytical methods in investigating osteogenesis and bone formation. Finally, recent developments in the manufacturing of Si-containing scaffolds are discussed, including in vitro and in vivo studies, as well as recently filed patents that focus on the influence of silicon on hard tissue formation.
During the last 50 years, a broad range of visible light curing resin based composites (VLC RBC) was developed for restorative applications in dentistry. Correspondingly, the technologies of light curing units (LCU) have changed from UV to visible blue light, and there from quartz tungsten halogen over plasma arc to LED LCUs increasing their light intensity significantly. In this thesis, the influence of the curing conditions in terms of irradiance, exposure time and irradiance distribution of LCU on reaction kinetics as well as corresponding mechanical and viscoelastic properties were investigated.
The following work presents algorithms for semi-automatic validation, feature extraction and ranking of time series measurements acquired from MOX gas sensors. Semi-automatic measurement validation is accomplished by extending established curve similarity algorithms with a slope-based signature calculation. Furthermore, a feature-based ranking metric is introduced. It allows for individual prioritization of each feature and can be used to find the best performing sensors regarding multiple research questions. Finally, the functionality of the algorithms, as well as the developed software suite, are demonstrated with an exemplary scenario, illustrating how to find the most power-efficient MOX gas sensor in a data set collected during an extensive screening consisting of 16,320 measurements, all taken with different sensors at various temperatures and analytes.
The simultaneous operation of multiple different semiconducting metal oxide (MOX) gas sensors is demanding for the readout circuitry. The challenge results from the strongly varying signal intensities of the various sensor types to the target gas. While some sensors change their resistance only slightly, other types can react with a resistive change over a range of several decades. Therefore, a suitable readout circuit has to be able to capture all these resistive variations, requiring it to have a very large dynamic range. This work presents a compact embedded system that provides a full, high range input interface (readout and heater management) for MOX sensor operation. The system is modular and consists of a central mainboard that holds up to eight sensor-modules, each capable of supporting up to two MOX sensors, therefore supporting a total maximum of 16 different sensors. Its wide input range is archived using the resistance-to-time measurement method. The system is solely built with commercial off-the-shelf components and tested over a range spanning from 100Ω to 5 GΩ (9.7 decades) with an average measurement error of 0.27% and a maximum error of 2.11%. The heater management uses a well-tested power-circuit and supports multiple modes of operation, hence enabling the system to be used in highly automated measurement applications. The experimental part of this work presents the results of an exemplary screening of 16 sensors, which was performed to evaluate the system’s performance.
Lignin ist bereits ein intensives Gebiet der Forschung, allerdings werden Verknüpfungen zwischen Quelle, Aufschlussmethode und Einsatz in der Literatur kaum beschrieben. In der vorliegenden Arbeit werden Lignine von verschiedenen Quellen (Weizenstroh, Buche, Nadelholz) und Aufschlussmethoden (AFEX, Wasserdampfaufschluss, Organosolv, Saure Hydrolyse) analytisch erfasst und hinsichtlich ihres Einsatzes in polymeren Materialien charakterisiert. Eine breite Auswahl an Methoden wurden eingesetzt, FT-IR- Spektroskopie, UV-Vis, 31P-NMR, GPC, Pyrolyse-GC/MS, sowie HPLC zur Bestimmung der Reinheit gemäß des NREL-Standard-Protokolls. Thermische Analysen, wie TGA und DSC zeigten Glasübergangstemperaturen um 120°C, sowie Zersetzungstemperaturen zwischen 340°C und 380°C. Die Ergebnisse weisen für das Organosolv-Buchenholz-Lignin hochreine Fraktionen auf, die bis dato noch nicht erreicht wurden. Die Ergebnisse dieser Arbeit identifizien die Organosolv-Buchenholz-Lignine als ein verwertbares Produkt im Hinblick auf die Anwendung in Polyurethanen sowie Phenol-Formaldehydharzen.
Cysticfibrosis (CF) arises from mutations in the CF transmembrane conductance regulator (CFTR) gene, resulting in progressiveand life-limiting respiratory disease. R751L is a rare CFTR mutation that is poorly characterized. Our aims were to describe theclinical and molecular phenotypes associated with R751L. Relevant clinical data were collected from three heterozygote individu-als harboring R751L (2 patients with G551D/R751L and 1 with F508del/R751L). Assessment of R751L-CFTR function was made inprimary human bronchial epithelial cultures (HBEs) andXenopusoocytes. Molecular properties of R751L-CFTR were investigatedin the presence of known CFTR modulators. Although sweat chloride was elevated in all three patients, the clinical phenotypeassociated with R751L was mild. Chloride secretion in F508del/R751L HBEs was reduced compared with non-CF HBEs and asso-ciated with a reduction in sodium absorption by the epithelial sodium channel (ENaC). However, R751L-CFTR function inXenopusoocytes, together with folding and cell surface transport of R751L-CFTR, was not different from wild-type CFTR. Overall,R751L-CFTR was associated with reduced sodium chloride absorption but had functional properties similar to wild-type CFTR.This is thefirst report of R751L-CFTR that combines clinical phenotype with characterization of functional and biological proper-ties of the mutant channel. Our work will build upon existing knowledge of mutations within this region of CFTR and, importantly,inform approaches for clinical management. Elevated sweat chloride and reduced chloride secretion in HBEs may be due to al-ternative non-CFTR factors, which require further investigation.
Typically, plastic packaging materials are produced using additives, like e.g. stabilisers, to introduce specific desired properties into the material or, in case of stabilisers, to prolong the shelf life of such packaging materials. However, those stabilisers are typically fossil-based and can pose risks to both environmental and human health. Therefore, the present study presents more sustainable alternatives based on regional renewable resources which show the relevant antioxidant, antimicrobial and UV absorbing properties to successfully serve as a plastic stabiliser. In the study, all plants are extracted and characterised with regard to not only antioxidant, antimicrobial and UV absorbing effects, but also with regard to additional relevant information like chemical constituents, molar mass distribution, absorbance in the visible range et cetera. The extraction process is furthermore optimised and, where applicable, reasonable opportunities for waste valorisation are explored and analysed. Furthermore, interactions between analysed plant extracts are described and model films based on Poly-Lactic Acid are prepared, incorporating analysed plant extracts. Based on those model films, formulation tests and migration analysis according to EU legislation is conducted.
The well-known aromatic and medicinal plant thyme (Thymus vulgaris L.) includes phenolic terpenoids like thymol and carvacrol which have strong antioxidant, antimicrobial and UV absorbing effects. Analyses show that those effects can be used in both lipophilic and hydrophilic surroundings, that the variant Varico 3 is a more potent cultivar than other analysed thyme variants, and that a passive extraction setup can be used for extract preparation while distillation of the Essential Oils can be a more efficient approach.
Macromolecular antioxidant polyphenols, particularly proanthocyanidins, have been found in the seed coats of the European horse chestnut (Aesculus hippocastanum L.) which are regularly discarded in phytopharmaceutical industry. In this study, such effects and compounds have been reported for the first time while a valorisation of waste materials has been analysed successfully. Furthermore, a passive extraction setup for waste materials and whole seeds has been developed. In extracts of snowdrops, precisely Galanthus elwesii HOOK.F., high concentrations of tocopherol have been found which promote a particularly high antioxidant capacity in lipophilic surroundings. Different coniferous woods (Abies div., Picea div.) which are in use as Christmas trees are extracted after separating the biomass in leafs and wood parts before being analysed regarding extraction optimisation and drought resistance of active substances. Antioxidant and UV absorbing proanthocyanidins are found even in dried biomasses, allowing the circular use of already used Christmas trees as bio-based stabilisers and the production of sustainable paper as a byproduct.
Background: To protect renewable packaging materials against autoxidation and decomposition when substituting harmful synthetic stabilizers with bioactive and bio-based compounds, extracts from Aesculus hippocastanum L. seeds were evaluated. The study objectives were to determine the antioxidant efficacy of bioactive compounds in horse chestnut seeds with regard to different seed fractions, improve their extraction, and to evaluate waste reuse. Methods: Different extraction techniques for field samples were evaluated and compared with extracts of industrial waste samples based on total phenolic content and total antioxidant capacity (2,2’-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid) (ABTS)). The molecular weight distribution and absorbance in ultraviolet range (UV) of seed coat extracts were determined, and the possibility of extracts containing proanthocyanidins was examined. Results: Seed coat extracts show a remarkable antioxidant activity and a high UV absorbance. Passive extractions are efficient and much less laborious. Applying waste product seed coats leads to a reduced antioxidant activity, total phenolic content, and UV absorbance compared to the field sample counterparts. In contrast to peeled seed extracts, all seed coat extracts contain proanthocyanidins. Discussion: Seed coats are a potential source of bioactive compounds, particularly regarding sustainable production and waste reuse. With minimum effort, highly bioactive extracts with high potential as additives can be prepared.
Different analyses and feasibility studies have been conducted on the plant extracts of thyme (Thymus vulgaris), European horse chestnut (Aesculus hippocastanum), Nordmann fir (Abies nordmanniana), and snowdrop (Galanthus elwesii) to evaluate bio‐based alternatives to common petrol‐based stabilisers. For this purpose, in this study, plant extracts were incorporated into poly‐lactic acid films (PLA) at different concentrations. The films’ UV absorbance and migration into packed food was analysed via photometric assays (ABTS radical cation scavenging capacity assay, β‐carotene assay) and GC–MS analysis. Furthermore, the synergistic antioxidant effects of various combinations of extracts and isolated active compounds were determined. This way, antioxidant effects can be increased, allowing for a highly effective use of resources. All extracts were successfully incorporated into PLA films and showed notable photoabsorbing effects, while no migration risk was observed. Depending on extract combinations, high synergistic effects of up to 726% can be utilised to improve the effectiveness of bio‐based extracts. This applies particularly to tomato paste and Aesculus hippocastanum extracts, which overall show high synergistic and antioxidant effects in combination with each other and with isolated active compounds. The study shows that it is possible to create safe bio‐based antioxidant films which show even improved properties when using highlighted target combinations.
Background: Coniferous woods (Abies nordmanniana (Stev.) Spach, Abies procera Rehd, Picea abies (L.) H.Karst, and Picea pungens Engelm.) could contain useful secondary metabolites to produce sustainable packaging materials, e.g., by substitution of harmful petrol-based additives in plastic packaging. This study aims to characterise the antioxidant and light-absorbing properties and ingredients of different coniferous wood extracts with regard to different plant fragments and drying conditions. Furthermore, the valorisation of used Christmas trees is evaluated. Methods: Different drying and extraction techniques were applied with the extracts being characterised by determining the total phenolic content (TPC), total antioxidant capacity (TAC), and absorbance in the ultraviolet range (UV). Gas chromatography coupled with mass spectrometry (GC-MS) and an acid–butanol assay (ABA) were used to characterise the extract constituents. Results: All the extracts show a considerably high UV absorbance while interspecies differences did occur. All the fresh and some of the dried biomass extracts reached utilisable TAC and TPC values. A simplified extraction setup for industrial application is evaluated; comparable TAC results could be reached with modifications. Conclusion: Coniferous woods are a promising renewable resource for preparation of sustainable antioxidants and photostabilisers. This particularly applies to Christmas trees used for up to 12 days. After extraction, the biomass can be fully valorised by incorporation in paper packaging.
Bei Thymian (Thymus vulgaris) handelt es sich um eine sehr varietätenreiche Art, die aufgrund ihres Gehaltes an therapeutisch wirksamen Inhaltsstoffen als Arzneipflanze monographiert ist. Insbesondere das ätherische Öl mit dem Hauptbestandteil Thymol (ca. 50%) hat eine hohe antioxidative Wirkung. Ziel ist es, dieses Potential als nachhaltig produzierte Additive zu nutzen. Hierfür eignen sich antioxidativ bzw. antimikrobiell wirksame sowie UV-absorbierende Substanzen, die das Produkt bei Zusatz vor oxidativem Stress, mikrobiellem Abbau und Qualitätsverlust schützen.
Hierzu werden zunächst sechs Varianten auf verschiedene Parameter analysiert, um die potenteste Variante auszuwählen. Auf diese Variante wird sich die weitere Forschung konzentrieren.
Daher wird das ätherische Öl durch azeotrope Destillation extrahiert und mittels GCMS analysiert. In Extrakten werden zudem das AP und Absorptionsverhalten bestimmt. Auch die chemische Zusammensetzung des Extrakts sowie die flüchtigen Stoffe des Thymians werden untersucht. Generell gibt es wenig qualitative, teilweise jedoch quantitative Unterschiede: Eine Variante weist u.a. einen deutlich höheren Thymolgehalt im Öl (ca. 65 %) und ein hohes hydrophiles AP auf. Somit ist eine vielversprechende Variante für die weitere Entwicklung und Optimierung bioaktiver Additive gefunden.
Holzfahrrad im Eigenbau
(2007)
Dieses Buch ganz besonders dazu geeignet, Studierenden in den ersten Semestern den Zugang zur Technischen Mechanik zu öffnen und ihnen dabei zu helfen, diese gefürchtete Prüfung des Maschinenbaustudiums erfolgreich zu bestehen. Mit rund 120 Beispielen und Aufgaben mit detaillierten Lösungen sowie Fallstudien zu interessanten mechanischen Fragen.
This volume of the series Springer Briefs in Space Life Sciences explains the physics and biology of radiation in space, defines various forms of cosmic radiation and their dosimetry, and presents a range of exposure scenarios. It also discusses the effects of radiation on human health and describes the molecular mechanisms of heavy charged particles’ deleterious effects in the body. Lastly, it discusses countermeasures and addresses the vital question: Are we ready for launch?
Written for researchers in the space life sciences and space biomedicine, and for master’s students in biology, physics, and medicine, the book will also benefit all non-experts endeavoring to understand and enter space.
Space exposure experiments from the last 15 years have unexpectedly shown that several terrestrial organisms, including some multi-cellular species, are able to survive in open space without protection. The robustness of bdelloid rotifers suggests that these tiny creatures can possibly be added to the still restricted list of animals that can deal with the exposure to harsh condition of space. Bdelloids are one of the smallest animals on Earth. Living all over the world, mostly in semi-terrestrial environments, they appear to be extremely stress tolerant. Their desiccation tolerance at any stage of their life cycle is known to confer tolerance to a variety of stresses including high doses of radiation and freezing. In addition, they constitute a major scandal in evolutionary biology due to the putative absence of sexual reproduction for at least 60 million years. Adineta vaga, with its unique characteristics and a draft genome available, was selected by ESA (European Space Agency) as a model system to study extreme resistance of organisms exposed to space environment. In this manuscript, we documented the resistance of desiccated A. vaga individuals exposed to increasing doses of X-ray, protons and Fe ions. Consequences of exposure to different sources of radiation were investigated in regard to the cellular type including somatic (survival assay) and germinal cells (fertility assay). Then, the capacity of A. vaga individuals to repair DNA DSB induced by different source of radiation was investigated. Bdelloid rotifers represent a promising model in order to investigate damage induced by high or low LET radiation. The possibility of exposure both on hydrated or desiccated specimens may help to decipher contribution of direct and indirect radiation damage on biological processes. Results achieved through this study consolidate our knowledge about the radioresistance of A. vaga and improve our capacity to compare extreme resistance against radiation among living organisms including metazoan.
Telogene Einzelhaare sind häufig vorkommende Spurentypen an Tatorten. Derzeit werden sie zumeist von der STR-Typisierung ausgeschlossen, weil ihre STR-Profile aufgrund geringer DNA-Mengen und starker DNA-Degradierung in vielen Fällen unvollständig und schwierig zu interpretieren sind. In der vorliegenden Arbeit wurde eine systematische Vorgehensweise angewandt, um Korrelationen zwischen der DNA-Menge und DNA-Degradierung zu dem Erfolg der STR-Typisierung aufzuweisen und darauf basierend den Typisierungs-Erfolg von DNA aus Haaren vorhersagen zu können.
Zu diesem Zweck wurde ein human- (RiboD) und ein canin-spezifischer (RiboDog) qPCR-basierter Assay zur Messung der DNA-Menge und Bewertung der DNA-Integrität mittels eines Degradierungswerts (D-Wert) entwickelt. Aufgrund der Lage der genutzten Primer, welche auf ubiquitär vorkommende ribosomale DNA-Sequenzen abzielen, ist das Funktionsprinzip schnell und kostengünstig auf unterschiedliche Spezies anzuwenden. Die Funktionsweise der Assays wurde mittels seriell degradierter DNA bestätigt und der humane Assay wurde im Vergleich zum kommerziellen Quantifiler? Trio DNA Quantification Kit validiert. Schließlich wurde mit den Assays an DNA aus telogenen und katagenen Einzelhaaren von Menschen und Hunden der Zusammenhang zwischen DNA-Menge und DNA-Integrität zu der Vollständigkeit der STR-Allele (Allel Recovery) von DNA-Profilen untersucht, die mittels kapillarelektrophoretischer (CE) STR-Kits erhaltenen wurde. Es zeigte sich, dass bei humanen Einzelhaaren die Allel-Recovery sowohl von der DNA-Menge als auch der DNA-Integrität abhängt. Dagegen war die DNA-Degradierung bei einzelnen Hundehaaren durchweg geringer und die Allel-Recovery hing allein von der extrahierten DNA-Menge ab.
Um die STR-Analytik degradierter humaner DNA-Proben weiter zu verbessern, wurde ein neuartiger NGS-basierter Assay (maSTR, Mini-Amplikon-STR) etabliert, der die 16 forensischen STR-Loci des European Standard Sets und Amelogenin als sehr kurze Amplikons (76-296 bp) parallel amplifiziert. Mit intakter DNA generierte der maSTR-Assay im Mengenbereich von 200 pg eingesetzter DNA reproduzierbare, vollständige Profile ohne Allelic Drop-ins. Bei niedrigeren DNA-Mengen traten vereinzelt Allelic Drop-ins auf, wobei unter Verwendung von mindestens 43 pg DNA vollständige Profile erhalten wurden.
Die kombinierte Strategie aus RiboD-Messungen der DNA-Menge und -Integrität und daraus resultierendem STR-Typisierungserfolg des maSTR-Assays wurde an degradierter DNA validiert. Anschließend wurde die Strategie auf DNA aus telogenen und katagenen Einzelhaaren angewandt und mit den Ergebnissen des CE-basierten PowerPlex? ESX 17-Kits verglichen, das dasselbe STR-Marker-Set analysiert. Dabei zeigte sich, dass der Erfolg der STR-Typisierung beider STR-Assays sowohl von der optimalen Menge der Template-DNA als auch von der DNA-Integrität abhängt. Mit dem maSTR-Assay wurden vollständige Profile mit ungefähr 50 pg Input-DNA für leicht degradierte DNA aus Einzelhaaren nachgewiesen, sowie mit ungefähr 500 pg stark degradierter DNA. Aufgrund der geringen DNA-Mengen von telogenen Einzelhaaren schwankte die Reproduzierbarkeit der maSTR-Ergebnisse, war jedoch stets dem PowerPlex? ESX 17-Kit in Bezug auf die Allel-Recovery überlegen.
Ein Vergleich mit zwei, hinsichtlich der Längenverteilung der Amplikons komplementären CE-basierten STR-Kits (PowerPlex? ESX 17 und ESI 17 Fast), sowie mit einem kommerziellen NGS-Kit (ForenSeq? DNA Signature Prep) ergab, dass nicht die Technik der NGS, sondern die Kürze der Amplikons der wichtigste Faktor zur Typisierung degradierter DNA ist. Der maSTR-Assay wies in allen Vergleichen mit den genutzten kommerziellen Kits jedoch eine höhere Anzahl an Allelic Drop-ins auf. Diese traten umso häufiger auf, je geringer die verwendete DNA-Menge und je stärker degradiert diese war.
Weil Profile mit Allelic Drop-ins Mischprofilen entsprechen, wurden die per maSTR-Assay generierten STR-Profile mit Verfahren zur Interpretation von Mischspuren untersucht. Bei der Composite-Interpretation werden alle vorkommenden Allele von Replikaten gezählt, bei der Consensus-Interpretation lediglich die reproduzierbaren Allele. Dabei stellte sich heraus, dass im Fall von wenigen Allelic Drop-ins (PowerPlex? ESX 17-generierte Profile) die Composite-Interpretation und bei Allelic Drop-in-haltigen Profilen (maSTR-generierte Profile) die Consensus-Interpretation am besten geeignet ist.
Schließlich wurde mittels der GenoProof Mixture 3-Software untersucht, inwieweit semi- und vollständig kontinuierliche probabilistische Verfahren bei der biostatistischen Bewertung der DNA-Profile aus Einzelhaaren geeignet sind. Dabei zeigte sich, dass der maSTR-Assay aufgrund der hohen Anzahl an Allelic Drop-ins den CE-basierten Methoden nur in Fällen von DNA leicht überlegen ist, die in ausreichender Menge und gering degradiert vorliegt. In diesem Bereich gelingt die Zuordnung des Profils aus Haaren zum Referenzprofil jedoch ebenfalls mittels CE-basierten Methoden.
Aus allen Ergebnissen wurde eine Empfehlung für die Handhabung von DNA aus ausgefallenen Einzelhaaren abgeleitet, die auf dem DNA-Degradierungsgrad in Kombination mit der DNA-Menge basiert. Die vorliegende Arbeit schafft somit eine Grundlage, um ausgefallene Einzelhaare in der Routine-Arbeit von kriminaltechnischen Ermittlungen nutzbar zu machen, sowie gegebenenfalls auf andere Spurentypen mit degradierter DNA geringer Menge anzuwenden. Dadurch könnte die Nutzbarkeit solcher Spurentypen für die forensische Kriminalistik erhöht werden, insbesondere wenn die standardmäßig verwendeten CE-basierten Methoden versagen. Perspektivisch ist die Technik der NGS aufgrund der großen Multiplexierbarkeit uniformer, kurzer Marker generell der CE-basierten Technik bei der Typisierung degradierter DNA überlegen.