Refine
Departments, institutes and facilities
- Fachbereich Informatik (62)
- Fachbereich Angewandte Naturwissenschaften (53)
- Institut für Technik, Ressourcenschonung und Energieeffizienz (TREE) (47)
- Fachbereich Wirtschaftswissenschaften (43)
- Fachbereich Ingenieurwissenschaften und Kommunikation (33)
- Internationales Zentrum für Nachhaltige Entwicklung (IZNE) (21)
- Institut für funktionale Gen-Analytik (IFGA) (15)
- Institut für Verbraucherinformatik (IVI) (14)
- Institute of Visual Computing (IVC) (13)
- Institut für Cyber Security & Privacy (ICSP) (10)
- Institut für Sicherheitsforschung (ISF) (7)
- Fachbereich Sozialpolitik und Soziale Sicherung (5)
- Graduierteninstitut (5)
- Zentrum für Innovation und Entwicklung in der Lehre (ZIEL) (5)
- Centrum für Entrepreneurship, Innovation und Mittelstand (CENTIM) (4)
- Institut für Detektionstechnologien (IDT) (1)
- Sprachenzentrum (1)
Document Type
- Article (110)
- Conference Object (53)
- Part of a Book (16)
- Preprint (12)
- Research Data (6)
- Doctoral Thesis (5)
- Master's Thesis (5)
- Report (4)
- Book (monograph, edited volume) (2)
- Conference Proceedings (2)
Year of publication
- 2022 (219) (remove)
Language
- English (219) (remove)
Keywords
- Machine Learning (5)
- virtual reality (4)
- Cathepsin K (3)
- GDPR (3)
- Knowledge Graphs (3)
- Lignin (3)
- usable privacy (3)
- 3D user interface (2)
- Bioinformatics (2)
- Chemometrics (2)
Virtual exchange
(2022)
Vection underwater
(2022)
Unlimited paid time off policies are currently fashionable and widely discussed by HR professionals around the globe. While on the one hand, paid time off is considered a key benefit by employees and unlimited paid time off policies (UPTO) are seen as a major perk which may help in recruiting and retaining talented employees, on the other hand, early adopters reported that employees took less time off than previously, presumably leading to higher burnout rates. In this conceptual review, we discuss the theoretical and empirical evidence regarding the potential effects of UPTO on leave utilization, well-being and performance outcomes. We start out by defining UPTO and placing it in a historical and international perspective. Next, we discuss the key role of leave utilization in translating UPTO into concrete actions. The core of our article constitutes the description of the effects of UPTO and the two pathways through which these effects are assumed to unfold: autonomy need satisfaction and detrimental social processes. We moreover discuss the boundary conditions which facilitate or inhibit the successful utilization of UPTO on individual, team, and organizational level. In reviewing the literature from different fields and integrating existing theories, we arrive at a conceptual model and five propositions, which can guide future research on UPTO. We conclude with a discussion of the theoretical and societal implications of UPTO.
TSEM: Temporally Weighted Spatiotemporal Explainable Neural Network for Multivariate Time Series
(2022)
Deep learning has become a one-size-fits-all solution for technical and business domains thanks to its flexibility and adaptability. It is implemented using opaque models, which unfortunately undermines the outcome trustworthiness. In order to have a better understanding of the behavior of a system, particularly one driven by time series, a look inside a deep learning model so-called posthoc eXplainable Artificial Intelligence (XAI) approaches, is important. There are two major types of XAI for time series data, namely model-agnostic and model-specific. Model-specific approach is considered in this work. While other approaches employ either Class Activation Mapping (CAM) or Attention Mechanism, we merge the two strategies into a single system, simply called the Temporally Weighted Spatiotemporal Explainable Neural Network for Multivariate Time Series (TSEM). TSEM combines the capabilities of RNN and CNN models in such a way that RNN hidden units are employed as attention weights for the CNN feature maps temporal axis. The result shows that TSEM outperforms XCM. It is similar to STAM in terms of accuracy, while also satisfying a number of interpretability criteria, including causality, fidelity, and spatiotemporality.
Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC50 of 50 μM. The binding motif can influence the activity of Hsp90 by hindering ATP accessibility or the release of ADP.
It is challenging to provide users with a haptic weight sensation of virtual objects in VR since current consumer VR controllers and software-based approaches such as pseudo-haptics cannot render appropriate haptic stimuli. To overcome these limitations, we developed a haptic VR controller named Triggermuscle that adjusts its trigger resistance according to the weight of a virtual object. Therefore, users need to adapt their index finger force to grab objects of different virtual weights. Dynamic and continuous adjustment is enabled by a spring mechanism inside the casing of an HTC Vive controller. In two user studies, we explored the effect on weight perception and found large differences between participants for sensing change in trigger resistance and thus for discriminating virtual weights. The variations were easily distinguished and associated with weight by some participants while others did not notice them at all. We discuss possible limitations, confounding factors, how to overcome them in future research and the pros and cons of this novel technology.
Regions and their innovation ecosystems have increasingly become of interest to CSCW research as the context in which work, research and design takes place. Our study adds to this growing discourse, by providing preliminary data and reflections from an ongoing attempt to intervene and support a regional innovation ecosystem. We report on the benefits and shortcomings of a practice-oriented approach in such regional projects and highlight the importance of relations and the notion of spillover. Lastly, we discuss methodological and pragmatic hurdles that CSCW research needs to overcome in order to support regional innovation ecosystems successfully.
Trojanized software packages used in software supply chain attacks constitute an emerging threat. Unfortunately, there is still a lack of scalable approaches that allow automated and timely detection of malicious software packages and thus most detections are based on manual labor and expertise. However, it has been observed that most attack campaigns comprise multiple packages that share the same or similar malicious code. We leverage that fact to automatically reproduce manually identified clusters of known malicious packages that have been used in real world attacks, thus, reducing the need for expert knowledge and manual inspection. Our approach, AST Clustering using MCL to mimic Expertise (ACME), yields promising results with a 𝐹1 score of 0.99. Signatures are automatically generated based on characteristic code fragments from clusters and are subsequently used to scan the whole npm registry for unreported malicious packages. We are able to identify and report six malicious packages that have been removed from npm consequentially. Therefore, our approach can support the detection by reducing manual labor and hence may be employed by maintainers of package repositories to detect possible software supply chain attacks through trojanized software packages.
Thermo-chemical conversion of cucumber peel waste for biobased energy and chemical production
(2022)
Therapeutic Treatments for Osteoporosis-Which Combination of Pills Is the Best among the Bad?
(2022)
Osteoporosis is a chronical, systemic skeletal disorder characterized by an increase in bone resorption, which leads to reduced bone density. The reduction in bone mineral density and therefore low bone mass results in an increased risk of fractures. Osteoporosis is caused by an imbalance in the normally strictly regulated bone homeostasis. This imbalance is caused by overactive bone-resorbing osteoclasts, while bone-synthesizing osteoblasts do not compensate for this. In this review, the mechanism is presented, underlined by in vitro and animal models to investigate this imbalance as well as the current status of clinical trials. Furthermore, new therapeutic strategies for osteoporosis are presented, such as anabolic treatments and catabolic treatments and treatments using biomaterials and biomolecules. Another focus is on new combination therapies with multiple drugs which are currently considered more beneficial for the treatment of osteoporosis than monotherapies. Taken together, this review starts with an overview and ends with the newest approaches for osteoporosis therapies and a future perspective not presented so far.
The corporate landscape is experiencing an increasing change in business models due to digitization. An increasing availability of data along the business processes enhance the opportunities for process automation. Technologies such as Robotic Process Automation (RPA) are widely used for business process optimization, but as a side effect an increase in stand-alone solutions and a lack of holistic approaches can be observed. Intelligent Process Automation (IPA) is said to support more complex processes and enable automated decision-making, but due to the lack of connectors makes the implementation difficult. RPA marketplaces can be a bridging technology to help companies implement Intelligent Process Automation. This paper explores the drivers and challenges for the adoption of RPA marketplaces to realize IPA. For this purpose, we conducted ten expert interviews with decision makers and IT staff from the process automation sector.
This edited volume on “Recent Advances in Renewable Energy” presents a selection of refereed papers presented at the 1st International Conference on Electrical Systems and Automation. The book provides rigorous discussions, the state of the art, and recent developments in the field of renewable energy sources supported by examples and case studies, making it an educational tool for relevant undergraduate and graduate courses. The book will be a valuable reference for beginners, researchers, and professionals interested in renewable energy.
This book which is the second part of two volumes on ''Control of Electrical and Electronic Systems” presents a compilation of selected contributions to the 1st International Conference on Electrical Systems & Automation. The book provides rigorous discussions, the state of the art, and recent developments in the modelling, simulation and control of power electronics, industrial systems, and embedded systems. The book will be a valuable reference for beginners, researchers, and professionals interested in control of electrical and electronic systems.
The Poverty Reduction Effect of Social Protection: The Pros and Cons of a Multidisciplinary Approach
(2022)
There is a growing body of knowledge on the complex effects of social protection on poverty in Africa. This article explores the pros and cons of a multidisciplinary approach to studying social protection policies. Our research aimed at studying the interaction between cash transfers and social health protection policies in terms of their impact on inclusive growth in Ghana and Kenya. Also, it explored the policy reform context over time to unravel programme dynamics and outcomes. The analysis combined econometric and qualitative impact assessments with national- and local-level political economic analyses. In particular, dynamic effects and improved understanding of processes are well captured by this approach, thus, pushing the understanding of implementation challenges over and beyond a ‘technological fix,’ as has been argued before by Niño-Zarazúa et al. (World Dev 40:163–176, 2012), However, multidisciplinary research puts considerable demands on data and data handling. Finally, some poverty reduction effects play out over a longer time, requiring longitudinal consistent data that is still scarce.
Background: Since presenteeism is related to numerous negative health and work-related effects, measures are required to reduce it. There are initial indications that how an organization deals with health has a decisive influence on employees’ presenteeism behavior.
Aims: The concept of health-promoting collaboration was developed on the basis of these indications. As an extension of healthy leadership it includes not only the leader but also co-workers. In modern forms of collaboration, leaders cannot be assigned sole responsibility for employees’ health, since the leader is often hardly visible (digital leadership) or there is no longer a clear leader (shared leadership). The study examines the concept of health-promoting collaboration in relation to presenteeism. Relationships between health-promoting collaboration, well-being and work ability are also in focus, regarding presenteeism as a mediator.
Methods: The data comprise the findings of a quantitative survey of 308 employees at a German university of applied sciences. Correlation and mediator analyses were conducted.
Results: The results show a significant negative relationship between health-promoting collaboration and presenteeism. Significant positive relationships were found between health-promoting collaboration and both well-being and work ability. Presenteeism was identified as a mediator of these relationships.
Conclusion: The relevance of health-promoting collaboration in reducing presenteeism was demonstrated and various starting points for practice were proposed. Future studies should investigate further this newly developed concept in relation to presenteeism.
The Chemotype of Chromanones as a Privileged Scaffold for Multineurotarget Anti-Alzheimer Agents
(2022)
Integrated solar water splitting devices that produce hydrogen without the use of power inverters operate outdoors and are hence exposed to varying weather conditions. As a result, they might sometimes work at non-optimal operation points below or above the maximum power point of the photovoltaic component, which would directly translate into efficiency losses. Up until now, however, no common parameter describing and quantifying this and other real-life operating related losses (e.g. spectral mismatch) exists in the community. Therefore, the annual-hydrogen-yield-climatic-response (AHYCR) ratio is introduced as a figure of merit to evaluate the outdoor performance of integrated solar water splitting devices. This value is defined as the ratio between the real annual hydrogen yield and the theoretical yield assuming the solar-to-hydrogen device efficiency at standard conditions. This parameter is derived for an exemplary system based on state-of-the-art AlGaAs//Si dual-junction solar cells and an anion exchange membrane electrolyzer using hourly resolved climate data from a location in southern California and from reanalysis data of Antarctica. This work will help to evaluate, compare and optimize the climatic response of solar water splitting devices in different climate zones.