Refine
H-BRS Bibliography
- yes (189) (remove)
Departments, institutes and facilities
- Fachbereich Angewandte Naturwissenschaften (189) (remove)
Document Type
- Article (175)
- Part of a Book (7)
- Preprint (4)
- Bachelor Thesis (1)
- Conference Object (1)
- Master's Thesis (1)
Year of publication
Has Fulltext
- yes (189) (remove)
Keywords
- lignin (7)
- cytokine-induced killer cells (6)
- GC/MS (5)
- Lignin (5)
- drug release (5)
- immunotherapy (5)
- scaffolds (5)
- biomaterial (4)
- osteogenesis (4)
- stem cells (4)
- DNA damage (3)
- ENaC (3)
- Miscanthus (3)
- SERS (3)
- additive (3)
- angiogenesis (3)
- antioxidant (3)
- biomass (3)
- bone tissue engineering (3)
- chemometrics (3)
- extraction (3)
- extremophiles (3)
- hydrogel (3)
- organosolv (3)
- tissue engineering (3)
- CIK cells (2)
- Composites (2)
- DNA typing (2)
- Folin-Ciocalteu assay (2)
- Gene expression (2)
- Graphene (2)
- IR microspectroscopy (2)
- Inborn error of metabolism (2)
- Ketone body (2)
- Mass spectrometry (2)
- Membrane Transport (2)
- Metabolic acidosis (2)
- Miscanthus x giganteus (2)
- Molecular dynamics (2)
- Nano-Systems (2)
- Organic aciduria (2)
- Polymers (2)
- Prognosis (2)
- Pyrolysis (2)
- R-ratio (2)
- SLC (2)
- active packaging (2)
- aluminum bonding wire (2)
- antimicrobial activity (2)
- antioxidant activity (2)
- autophagy (2)
- bacteria (2)
- bio-based polymers (2)
- bioeconomy (2)
- bone regeneration (2)
- cell migration (2)
- classification (2)
- creep (2)
- cytokine-induced killer (CIK) cells (2)
- discriminant analysis (2)
- essential oil (2)
- extraterrestrial analogue (2)
- extremophile (2)
- food waste (2)
- force generation (2)
- fungi (2)
- ketogenesis (2)
- kraft lignin (2)
- life detection (2)
- lifetime prediction (2)
- lignocellulose feedstock (2)
- low-input crops (2)
- melanin (2)
- mesenchymal stem cells (2)
- modeling (2)
- monolignol ratio (2)
- multivariate data processing (2)
- myosin (2)
- natural additives (2)
- organic aciduria (2)
- osteoblast (2)
- osteoclast (2)
- permeability (2)
- photonic sensing (2)
- plant extracts (2)
- poly(butylene adipate terephthalate) (2)
- poly(lactic acid) (2)
- power electronics (2)
- scaffold (2)
- shelf life (2)
- small-scale fatigue testing (2)
- stress response (2)
- sustainable packaging (2)
- total phenol content (2)
- ultrapure water (2)
- (poly)saccharides (1)
- 16S rRNA gene sequencing (1)
- 2B4 (1)
- 3-hydroxy-n-butyric acid (1)
- 3-hydroxyisobutyrate dehydrogenase (1)
- 3-hydroxyisobutyrate dehydrogenase deficiency (1)
- 3-hydroxyisobutyric aciduria (1)
- ACAT1 (1)
- ACacylcarnitines (1)
- ADP release (1)
- AMAtypical myopathy (1)
- AOP (1)
- APC superfamily (1)
- ATB0,+ (1)
- ATPase cycle (1)
- ATR-FTIR (1)
- Abies nordmanniana (1)
- Abies procera (1)
- Additiv (1)
- Additive (1)
- Adipogenic effect (1)
- Adipose tissue-derived stem cells (1)
- Affinity proteomics (1)
- Aloe vera (1)
- Ankle Joint (1)
- Antarctic Polar Plateau (1)
- Antarctic ice sheet (1)
- Anti-inflammatory effects (1)
- Antibodies* (1)
- Antibody Induced Arthritis (1)
- Antioxidant capacity (1)
- Antioxidative Capacity (1)
- Antioxidatives Potential (1)
- Articular Cartilage (1)
- Assay development (1)
- Assay reproducibility (1)
- Asymmetric cell division (1)
- Atlantic coast (1)
- AuNPs (1)
- Automation (1)
- Automobilindustrie (1)
- Automotive Industry (1)
- BLAST (1)
- Bacillus (1)
- Bacteria, Anaerobic (1)
- Beta-ketothiolase (1)
- BioMark HD microfluidic system (1)
- Bioactive (1)
- Bioaktiv (1)
- Biological databases (1)
- Biophysics (1)
- Biopolymers (1)
- Bone marrow-derived stem cells (1)
- Breast cancer (1)
- CD30+ cells (1)
- CD40, CTLA-4 (1)
- CDH1 (1)
- CDKN1B (1)
- CFTR inhibitors (1)
- CFTR mutations (1)
- CIK-Zellen (1)
- Calcium (1)
- Calcium Intracellular Release (1)
- Cancer (1)
- Cannabinoids (1)
- Cardiovascular Disease (1)
- Cartilage Destruction (1)
- Cathepsin K (1)
- Cell Cycle (1)
- Cell Differentiation (1)
- Cell Signaling (1)
- Cell lineage (1)
- Cervical cancer screening (1)
- Cervicovaginal microbiome (1)
- Chaetocin (1)
- Chemical calculations (1)
- Chemical imaging (1)
- Chemometrics (1)
- Chemotherapy (1)
- Chromatography (1)
- Cislunar (1)
- Classification (1)
- Colposcopy (1)
- Compressive strength (1)
- Corrosion protction (1)
- DBSdried blot spots (1)
- DNA (1)
- DNA Transcription (1)
- DNA double- strand breaks (1)
- DNA extraction protocols (1)
- DNA interaction (1)
- DNA methylation (1)
- DNA profile (1)
- Development (1)
- Docking (1)
- E-cadherin (1)
- E/I balance (1)
- ER stress (1)
- ERO1α (1)
- ESKAPEE pathogens (1)
- Elephantiasis (1)
- Endosomes (1)
- Epitope mapping: Epitope extraction (1)
- European horse chestnut (1)
- Eutectic Ti-Fe alloys (1)
- Explosives (1)
- Extrusionsblasformen (1)
- FMR1 (1)
- Fabry disease (1)
- Familial glioma (1)
- Fe-ion radiation (1)
- Fiber reinforcement (1)
- Foaming (1)
- Forensic genetics (1)
- Fragile X Syndrome (1)
- GC–MSgas chromatography–mass spectrometry (1)
- GMX1778 (1)
- Galactic Cosmic Rays (GCRs) (1)
- Gasturbinenschaufel (1)
- Gelatin Zymography (1)
- Genes (1)
- Geopolymer (1)
- Glycine N-acyltransferase (1)
- Glycine conjugation (1)
- Growth (1)
- HIBADH (1)
- HIBADH deficiency (1)
- HMGCL (1)
- HPV diagnostic (1)
- HS SPME (1)
- HSP90 (1)
- HSQC NMR (1)
- High temperature deformation (1)
- High temperature laser powder bed fusion (1)
- Homeobox (1)
- Humans (1)
- Hyperammonemia (1)
- Hypoglycemia (1)
- ICP OES (1)
- Illegal Wildlife Trade (1)
- Immune escape (1)
- Immunology* (1)
- In silico epitope prediction (1)
- In silico modelling (1)
- Inhibitor (1)
- Intact proinsulin (1)
- Ionic liquids (1)
- Isoleucine (1)
- Isovaleric acidemia (1)
- Joint Destruction (1)
- K/BxN (1)
- Karl Fischer titration (1)
- Ketogenesis (1)
- Ketolysis (1)
- Kriechen (1)
- LET (1)
- LFA-1 (1)
- LSPR (1)
- Lebensdauervorhersage (1)
- Leg (1)
- LeuT (1)
- Leucine (1)
- Ligand -Receptor Interactions* (1)
- Linear viscoelasticity (1)
- Lineare Viskoelastizität (1)
- Liquid crystal (1)
- Liquid-liquid extraction (LLE) (1)
- Lymphedema (1)
- Lysosomes (1)
- MADDMultiple acyl-CoA dehydrogenase deficiency (1)
- MCT (1)
- MICA/B (1)
- MMP-9 (1)
- MOX gas sensors (1)
- MPV17 monoclonal antibody (1)
- Machine learning (1)
- Malus genotypes (1)
- Mars (1)
- Mars environment (1)
- Mass transport (1)
- Meat-associated Microorganisms (1)
- Mechanical properties of materials (1)
- Mechanische Prüfung (1)
- Mesenchymal stromal cells (1)
- Metabolic decompensation (1)
- Metabolicdecompensation (1)
- Miscanthus nagara (1)
- Miscanthus robustus (1)
- Miscanthus sinensis (1)
- Mitochondria (1)
- Mitochondrial DNA depletion syndrome (1)
- Molecular Dynamics (1)
- Multimodal hyperspectral data (1)
- Mxi-2 (1)
- N-isovalerylglycine (1)
- NAI (1)
- NDVI (1)
- NFκB pathway (1)
- NGS (1)
- NKG2D (1)
- NLRP3 inflammasome (1)
- NSS family (1)
- Nafion™ (1)
- Nanoparticles (1)
- Near-field synchrotron ptychographic X-ray computed tomography (1)
- Nickel-based superalloy (1)
- Nickelbasis-Superlegierung (1)
- Node involvement (1)
- Non-covalent interaction MS* (1)
- O3/UV (1)
- OA, organic acids (1)
- OH-number (1)
- Off-target effects (1)
- Oligodendroglioma (1)
- Orai1 (1)
- Organic acids (1)
- Orion (1)
- P1 receptor (1)
- P2 receptor (1)
- PCR inhibitors (1)
- PD-1/CTLA-4 (1)
- PDI (1)
- PEM electrolysis (1)
- PLASM (1)
- Pathogenic Bacteria (1)
- Pattern recognition (1)
- Patterning (1)
- Paulownia (1)
- Permeation (1)
- Peroxisomes (1)
- Phenyls (1)
- Picea abies (1)
- Picea pungens (1)
- Pleiotropic drug resistance (1)
- Polymorphism (1)
- Polysaccharide derivatives (1)
- Protein complex analysis (1)
- Purinergic signaling (1)
- Pyrolyse-GC/MS (1)
- Pyrolysis GC/MS (1)
- R751L (1)
- Raman Spectroscopy (1)
- Raman spectroscopy (1)
- Raman-microspectroscopy (1)
- Regeneration (1)
- Regenerative medicine (1)
- Resins (1)
- RheoTack analysis (1)
- SAXS (1)
- SCNN1D (1)
- SEC (1)
- SGN-35 (1)
- SHAP (1)
- SLC6 (1)
- SLC6A14 (1)
- SNPSTR (1)
- STARLIFE project (1)
- STF-31 (1)
- Saccharomyces cerevisiae (1)
- Sample digestion (1)
- Schadensanalyse (1)
- Schwindung (1)
- Self-assembling (1)
- Short tandem repeat (STR) (1)
- Silica gel (1)
- Silicon Carbides (1)
- Silphium (1)
- Skin (1)
- Solution chemistry (1)
- Space radiation (1)
- Spectroscopy (1)
- Stem cell differentiation (1)
- Stem cells (1)
- Steroidal saponin (1)
- Store-operated calcium entry (1)
- Supervised classification (1)
- Sweet cherry (Prunus avium L.) (1)
- TOC (1)
- Tap water (1)
- Targeted mass spectrometry (1)
- Therapeutic antibodies* (1)
- Thermal conductivity (1)
- Thermoplastic polyurethanes (1)
- Thyme (1)
- Thymian (1)
- TiO2-coatings (1)
- Transcription Regulation (1)
- Treatment (1)
- UV (1)
- UV Absorption (1)
- UV absorbance (1)
- UV spectrum (1)
- UV-Absorption (1)
- UV-VIS (1)
- UV-vis spectroscopy (1)
- Ultrafine microstructures (1)
- Unconjugated THC-COOH (1)
- Used engine oil (1)
- Vascular Smooth Muscle Cells (1)
- Verzug (1)
- Vibrational microspectroscopy (1)
- Vim3 (1)
- Visceral lipid tissue (1)
- WAXS (1)
- WZB117 (1)
- Whole genome amplification (1)
- Whole-genome sequencing (1)
- Wild Type Mouse (1)
- Wildlife Forensics (1)
- X-STR (1)
- X-ray powder diffraction (XRD) (1)
- XGBoost (1)
- XRD (1)
- Y-STR (1)
- Yeast (1)
- Zytokin-induzierte Killerzellen (1)
- accelerated iron ions (1)
- acetoacetic acid (1)
- acetone (1)
- acidic ethanosolv (1)
- actin (1)
- actinometry (1)
- adhesion factor (1)
- aerogels (1)
- agarose (1)
- alkyl amines (1)
- allosteric communication (1)
- altered mitochondrial homeostasis (1)
- amelogenesis (1)
- amino acid transporter (1)
- amplicon sequencing (1)
- anabolic (1)
- anaplastic lymphoma kinase (1)
- antibiotic prophylaxis (1)
- antibody–drug conjugate (1)
- antiradical activity (1)
- apoptosis (1)
- apple replant disease (ARD) (1)
- ash (1)
- astrobiology (1)
- autism spectrum disorders (1)
- autohydrolysis (1)
- autologous bone graft (1)
- automated electrophysiology (1)
- automated sensor-screening (1)
- automatic measurement validation (1)
- automation of sample processing (1)
- azadipeptide nitrile (1)
- bagasse (1)
- bdelloid rotifer (1)
- beaching (1)
- behavior and cognition (1)
- bio-innovation (1)
- biochemical fingerprinting (1)
- biocomposite (1)
- biofilm removal (1)
- biofilm-related infections (1)
- bioinformatics (1)
- biomarker (1)
- biopolymer (1)
- bio‐based (1)
- black fungi (1)
- blebbistatin (1)
- blood vessel (1)
- blow molding (1)
- blown film (1)
- blown film extrusion (1)
- bone (1)
- bone mineral density (1)
- bone remodeling (1)
- branched-chain amino acids (1)
- breast cancer (1)
- breast carcinoma (1)
- brilliant green (1)
- built environment (1)
- cancer biomarker (1)
- cancer treatment (1)
- cannabidiol, immunotherapy (1)
- caspase (1)
- catabolic (1)
- cell death (1)
- cell division (1)
- cell harvesting (1)
- cell viability (1)
- cementogenesis (1)
- chaetocin (1)
- chain extenders cross-linker (1)
- chain extending cross-linker (1)
- chain-extending cross-linker (1)
- chemosensing (1)
- chiral-nematic (1)
- chitosan (1)
- cholesteric liquid crystals (1)
- cholesteric phase (1)
- clear cell renal cell carcinoma (1)
- clinical trials (1)
- coaxial electrospinning (1)
- coffee ring effect (1)
- collagen (1)
- combination of treatments (1)
- composites (1)
- condensation (1)
- coniferous woods (1)
- core-sheath fibers (1)
- cosmic rays (1)
- creep compliance (1)
- cross-linking (1)
- crystal violet (1)
- crystallinity (1)
- cube in cube model (1)
- cyanohydrazide warhead (1)
- cysteine proteases (1)
- cysticfibrosis (1)
- cytoskeleton (1)
- data base search (1)
- deformation behavior (1)
- degraded DNA (1)
- degree of disintegration (1)
- delta-subunit (1)
- demethylation (1)
- dental implant (1)
- dental stem cells (1)
- dental stem cells immortalization (1)
- dentinogenesis (1)
- dentogenesis (1)
- depolymerization (1)
- desert cyanobacteria (1)
- detaching (1)
- diagnosis and management (1)
- differentiation (1)
- diffusion (1)
- disintegration kinetics (1)
- dissolved ozone (1)
- drug delivery (1)
- drug release materials (1)
- duty ratio (1)
- electroless copper deposition (1)
- electrospinning (1)
- elementary volume (1)
- encapsulation (1)
- endoplasmic reticulum (ER) stress (1)
- endothelial cell (1)
- endothelial cell differentiation (1)
- endothelial cells (1)
- enzyme activity (1)
- epithelial sodium channel (1)
- epitope mapping (1)
- evolution (1)
- exon fusion (1)
- extraction-linked bias (1)
- extrusion blow molding (1)
- fasentin (1)
- fatty acid metabolism (1)
- feature (1)
- fiber composites (1)
- fluorinated salts (1)
- food contact material (1)
- food safety (1)
- food-related bacteria (1)
- forensic (1)
- forensic genetics (1)
- formulation (1)
- fungal and bacterial amplicon sequencing (1)
- gas sensor (1)
- gas turbine blade (1)
- gene expression (1)
- genomic data (1)
- genotype (1)
- geopolymer (1)
- geopolymer foam (1)
- glucose uptake inhibitor (1)
- greenhouse bio-test (1)
- growth factors (1)
- guidelines (1)
- habitability (1)
- halogen bonding (1)
- harvest prediction (1)
- healthcare-associated infections (HAI) (1)
- heavy ion particle (HZE) radations (1)
- helical twisting power (1)
- heterocyclic (1)
- high diagnostic coverage and reliability (1)
- high dynamic range resistance readout (1)
- high-sensitivity C-reactive protein (hsCRP) (1)
- high-throughput DNA sequencing (1)
- high-throughput qRT-PCR (1)
- high-throughput sequencing (1)
- histone deacetylase inhibitors (1)
- homeostatic model assessment (HOMA) (1)
- hospital environment (1)
- hospital-acquired infections (1)
- human cathepsins (1)
- human microbiome (1)
- hydrogen bonding (1)
- hydroxyapatite (1)
- hydroxypropylmethylcellulose (1)
- hypertension (1)
- hypoxia (1)
- iPSCs (1)
- immune checkpoint inhibition programmed cell death-1 (1)
- impact monitoring (1)
- impregnation-reduction (1)
- infection prevention (1)
- infrared spectroscopy (1)
- inherited metabolic disease (1)
- insulin resistance (1)
- intact proinsulin (1)
- integrative Simulation (1)
- integrative simulation (1)
- invasion (1)
- ionic polymer metal (1)
- isoleucine (1)
- ketolysis (1)
- ketone body synthesis (1)
- klarzelliges Nierenzellkarzinom (1)
- leishmaniasis (1)
- leucine (1)
- leucine degradation (1)
- life on Mars (1)
- lignin structure analysis (1)
- lignocellulosic feedstock (1)
- liquid crystal (1)
- liquid crystals (1)
- long interspersed nuclear element-1 (1)
- low molecular weight (1)
- low-level laser therapy (1)
- lymphoma (1)
- massive parallel sequencing (1)
- maturity index (1)
- mechanical properties (1)
- mechanical testing (1)
- mesenchymal stem cell (1)
- mesogens (1)
- metabolically active cells (1)
- metal-oxide-semiconductor gas sensors (1)
- methylmalonic acidaemia (1)
- methylmalonic acidemia (1)
- miR-15 (1)
- miR-498 (1)
- microbial community structure (1)
- microbial contamination (1)
- microbial ecology (1)
- microbiome (1)
- microbiome analyses (1)
- micromanipulation (1)
- microplastic (1)
- microsatellite instability (1)
- migration (1)
- mitochondrial biogenesis (1)
- molecular docking (1)
- molecular dynamics simulations (1)
- molecular mass degradation (1)
- molecular motor (1)
- molecular pathology (1)
- monoclonal antibody (1)
- morphology (1)
- mouse model (1)
- multi-drug response (1)
- multiple myeloma (1)
- multivariate data analysis (1)
- multivariate statistics (1)
- myogenesis (1)
- nanomedicine (1)
- natural fiber (1)
- neoexpression (1)
- neuroendocrine (1)
- next generation sequencing (1)
- nitrile inhibitors (1)
- nitrogen dioxide (1)
- non-apoptotic roles (1)
- non-small cell lung cancer (1)
- non-woven fiber mats (1)
- nondestructive examination (1)
- nosocomial infections (1)
- nutrient germinants (1)
- odontogenic cells (1)
- operando Raman spectroscopies (1)
- organic acid analysis (1)
- organoids (1)
- organosolv lignin (1)
- orthotropes prozessabhängiges Materialverhalten (1)
- orthotropic process-dependent material behavior (1)
- osteogenic potential (1)
- osteoporosis (1)
- outer space (1)
- ozonation (1)
- ozone (1)
- p27 (1)
- panspermia (1)
- partial squares regression (1)
- particulate composite (1)
- patent (1)
- pathogen control (1)
- pathogenic microorganisms (1)
- pathophysiology (1)
- peptide sequencing (1)
- photocatalysis (1)
- photolysis (1)
- photostabiliser (1)
- phytoalexins (1)
- planetary protection (1)
- plastic pollution (1)
- polybutylene adipate terephthalate (1)
- polylactic acid (1)
- polymers (1)
- polyphenols (1)
- polysaccharide (1)
- polyurethane coatings (1)
- potentiometric sensors (1)
- power industry (1)
- power stroke (1)
- pressure sensitive adhesives (1)
- primary airway epithelial cells (1)
- primates (1)
- principal component analysis (1)
- prioritizable ranking (1)
- proanthocyanidins (1)
- probiotic cleaning (1)
- probiotic-based cleaning formulations (1)
- process parameters (1)
- process-induced morphology (1)
- proliferation (1)
- propionic acidaemia (1)
- propionic acidemia (1)
- protease inhibitor (1)
- protein microarray (1)
- prototype apparatus (1)
- pseudogene (1)
- purinergic receptor (1)
- purinergic receptors (1)
- qNMR (1)
- radiation (1)
- radioresistance (1)
- renal cancer (1)
- renal cell carcinoma (1)
- renal tubular cells (1)
- resistance (1)
- retraction speed dependency (1)
- rodent (1)
- rodents (1)
- scratch assay (1)
- seed coat (1)
- semiconducting metal oxide gas sensor array (1)
- sensor array (1)
- sensory characterisation (1)
- sequencing (1)
- sexual assault (1)
- short tandem repeat (1)
- short tandem repeat (STR) (1)
- shrinkage (1)
- sirtuins (1)
- size exclusion chromatography (1)
- slope based signature (1)
- smooth muscle cell (1)
- smooth muscle cell differentiation (1)
- sodium self-inhibition (1)
- soil properties (1)
- sol-gel support (1)
- solute carrier (1)
- solvent exchange (1)
- space radiation environment (1)
- sperm cell (1)
- spore resistance (1)
- sporegermination (1)
- stabilisation (1)
- stabiliser (1)
- staurosporine (1)
- stem cell (1)
- structural biology (1)
- structural coloration (1)
- structure (1)
- supercritical drying (1)
- supramolecular liquid crystals (1)
- surface modification (1)
- surface sanitization (1)
- surrogate endpoint (1)
- survival (1)
- sweet sorghum (1)
- synergistic effect (1)
- temperature influence (1)
- therapy (1)
- thermal insulation material (1)
- thermal insulation materials (1)
- thermo-mechanical properties (1)
- thermophoresis (1)
- thermosensing (1)
- thin film (1)
- time series analysis (1)
- total phenolic content (1)
- transcriptional regulation (1)
- transient kinetics (1)
- transient receptor potential vanilloid Type 2 (1)
- triacetone triperoxides (1)
- triiodothyronine (1)
- triphenylmethane dyes (1)
- tumor diagnosis (1)
- tunable pitch (1)
- tunable sheet resistance (1)
- tungsten oxides (1)
- two-electrode voltage clamp (1)
- type 2 diabetes (1)
- unfolded protein response (UPR) (1)
- valine degradation (1)
- volatile organic compound (VOC) sensing (1)
- warpage (1)
- wearable technology (1)
- whole genome amplification (WGA) (1)
- whole-tooth regeneration (1)
- wound healing assay (1)
- yin-yang effect (1)
- zona pellucida protein 2 ZP2 (1)
- β-amino acids (1)
- β-catenin (1)
- β-cell dysfunction (1)
A biodegradable blend of PBAT—poly(butylene adipate-co-terephthalate)—and PLA—poly(lactic acid)—for blown film extrusion was modified with four multi-functional chain extending cross-linkers (CECL). The anisotropic morphology introduced during film blowing affects the degradation processes. Given that two CECL increased the melt flow rate (MFR) of tris(2,4-di-tert-butylphenyl)phosphite (V1) and 1,3-phenylenebisoxazoline (V2) and the other two reduced it (aromatic polycarbodiimide (V3) and poly(4,4-dicyclohexylmethanecarbodiimide) (V4)), their compost (bio-)disintegration behavior was investigated. It was significantly altered with respect to the unmodified reference blend (REF). The disintegration behavior at 30 and 60 °C was investigated by determining changes in mass, Young’s moduli, tensile strengths, elongations at break and thermal properties. In order to quantify the disintegration behavior, the hole areas of blown films were evaluated after compost storage at 60 °C to calculate the kinetics of the time dependent degrees of disintegration. The kinetic model of disintegration provides two parameters: initiation time and disintegration time. They quantify the effects of the CECL on the disintegration behavior of the PBAT/PLA compound. Differential scanning calorimetry (DSC) revealed a pronounced annealing effect during storage in compost at 30 °C, as well as the occurrence of an additional step-like increase in the heat flow at 75 °C after storage at 60 °C. The disintegration consists of processes which affect amorphous and crystalline phase of PBAT in different manner that cannot be understood by a hydrolytic chain degradation only. Furthermore, gel permeation chromatography (GPC) revealed molecular degradation only at 60 °C for the REF and V1 after 7 days of compost storage. The observed losses of mass and cross-sectional area seem to be attributed more to mechanical decay than to molecular degradation for the given compost storage times.
Background: the potency of drugs that interfere with glucose metabolism, i.e., glucose transporters (GLUT) and nicotinamide phosphoribosyltransferase (NAMPT) was analyzed in neuroendocrine tumor (NET, BON-1, and QPG-1 cells) and small cell lung cancer (SCLC, GLC-2, and GLC-36 cells) tumor cell lines. (2) Methods: the proliferation and survival rate of tumor cells was significantly affected by the GLUT-inhibitors fasentin and WZB1127, as well as by the NAMPT inhibitors GMX1778 and STF-31. (3) Results: none of the NET cell lines that were treated with NAMPT inhibitors could be rescued with nicotinic acid (usage of the Preiss–Handler salvage pathway), although NAPRT expression could be detected in two NET cell lines. We finally analyzed the specificity of GMX1778 and STF-31 in NET cells in glucose uptake experiments. As previously shown for STF-31 in a panel NET-excluding tumor cell lines, both drugs specifically inhibited glucose uptake at higher (50 μM), but not at lower (5 μM) concentrations. (4) Conclusions: our data suggest that GLUT and especially NAMPT inhibitors are potential candidates for the treatment of NET tumors.
PURPOSE
Cervical cancer (CC) is caused by a persistent high-risk human papillomavirus (hrHPV) infection. The cervico-vaginal microbiome may influence the development of (pre)cancer lesions. Aim of the study was (i) to evaluate the new CC screening program in Germany for the detection of high-grade CC precursor lesions, and (ii) to elucidate the role of the cervico-vaginal microbiome and its potential impact on cervical dysplasia.
METHODS
The microbiome of 310 patients referred to colposcopy was determined by amplicon sequencing and correlated with clinicopathological parameters.
RESULTS
Most patients were referred for colposcopy due to a positive hrHPV result in two consecutive years combined with a normal PAP smear. In 2.1% of these cases, a CIN III lesion was detected. There was a significant positive association between the PAP stage and Lactobacillus vaginalis colonization and between the severity of CC precursor lesions and Ureaplasma parvum.
CONCLUSION
In our cohort, the new cervical cancer screening program resulted in a low rate of additional CIN III detected. It is questionable whether these cases were only identified earlier with additional HPV testing before the appearance of cytological abnormalities, or the new screening program will truly increase the detection rate of CIN III in the long run. Colonization with U. parvum was associated with histological dysplastic lesions. Whether targeted therapy of this pathogen or optimization of the microbiome prevents dysplasia remains speculative.
Forensic DNA profiles are established by multiplex PCR amplification of a set of highly variable short tandem repeat (STR) loci followed by capillary electrophoresis (CE) as a means to assign alleles to PCR products of differential length. Recently, CE analysis of STR amplicons has been supplemented by high-throughput next generation sequencing (NGS) techniques that are able to detect isoalleles bearing sequence polymorphisms and allow for an improved analysis of degraded DNA. Several such assays have been commercialised and validated for forensic applications. However, these systems are cost-effective only when applied to high numbers of samples. We report here an alternative, cost-efficient shallow-sequence output NGS assay called maSTR assay that, in conjunction with a dedicated bioinformatics pipeline called SNiPSTR, can be implemented with standard NGS instrumentation. In a back-to-back comparison with a CE-based, commercial forensic STR kit, we find that for samples with low DNA content, with mixed DNA from different individuals, or containing PCR inhibitors, the maSTR assay performs equally well, and with degraded DNA is superior to CE-based analysis. Thus, the maSTR assay is a simple, robust and cost-efficient NGS-based STR typing method applicable for human identification in forensic and biomedical contexts.
Isovaleric acidemia (IVA), due to isovaleryl-CoA dehydrogenase (IVD) deficiency, results in the accumulation of isovaleryl-CoA, isovaleric acid and secondary metabolites. The increase in these metabolites decreases mitochondrial energy production and increases oxidative stress. This contributes to the neuropathological features of IVA. A general assumption in the literature exists that glycine N-acyltransferase (GLYAT) plays a role in alleviating the symptoms experienced by IVA patients through the formation of N-isovalerylglycine. GLYAT forms part of the phase II glycine conjugation pathway in the liver and detoxifies excess acyl-CoA’s namely benzoyl-CoA. However, very few studies support GLYAT as the enzyme that conjugates isovaleryl-CoA to glycine. Furthermore, GLYATL1, a paralogue of GLYAT, conjugates phenylacetyl-CoA to glutamine. Therefore, GLYATL1 might also be a candidate for the formation of N-isovalerylglycine. Based on the findings from the literature review, we proposed that GLYAT or GLYATL1 can form N-isovalerylglycine in IVA patients. To test this hypothesis, we performed an in-silico analysis to determine which enzyme is more likely to conjugate isovaleryl-CoA with glycine using AutoDock Vina. Thereafter, we performed in vitro validation using purified enzyme preparations. The in-silico and in vitro findings suggested that both enzymes could form N-isovaleryglycine albeit at lower affinities than their preferred substrates. Furthermore, an increase in glycine concentration does not result in an increase in N-isovalerylglycine formation. The results from the critical literature appraisal, in-silico, and in vitro validation, suggest the importance of further investigating the reaction kinetics and binding behaviors between these substrates and enzymes in understanding the pathophysiology of IVA.
This research studies in detail four different assays, namely DPPH (2,2-diphenyl-1-picrylhydrazyl), ABTS (2,2'-azino-bis(3-ethylbenzothiazoline-6-sulfonic acid)), FRAP (ferric ion reducing antioxidant potential) and FC (Folin-Ciocalteu), to determine the antioxidant capacity of standard substances as well as 50 organosolv lignins, and two kraft lignins. The coefficient of variation was determined for each method and was lowest for ABTS and highest for DPPH. The best correlation was found for FRAP and FC, which both rely on a single electron transfer mechanism. A good correlation between ABTS, FRAP and FC, respectively, could be observed, even though ABTS relies on a more complex reaction mechanism. The DPPH assay merely correlates with the others, implying that it reflects different antioxidative attributes due to a different reaction mechanism. Lignins obtained from paulownia and silphium have been investigated for the first time regarding their antioxidant capacity. Paulownia lignin is in the same range as beech wood lignin, while silphium lignin resembles wheat straw lignin. Miscanthus lignin is an exception from the grass lignins and possesses a significantly higher antioxidant capacity. All lignins possess a good antioxidant capacity and thus are promising candidates for various applications, e. g. as additives in food packaging or for biomedical purposes.
Indoor spaces exhibit microbial compositions that are distinctly dissimilar from one another and from outdoor spaces. Unique in this regard, and a topic that has only recently come into focus, is the microbiome of hospitals. While the benefits of knowing exactly which microorganisms propagate how and where in hospitals are undoubtedly beneficial for preventing hospital-acquired infections, there are, to date, no standardized procedures on how to best study the hospital microbiome. Our study aimed to investigate the microbiome of hospital sanitary facilities, outlining the extent to which hospital microbiome analyses differ according to sample-preparation protocol. For this purpose, fifty samples were collected from two separate hospitals—from three wards and one hospital laboratory—using two different storage media from which DNA was extracted using two different extraction kits and sequenced with two different primer pairs (V1–V2 and V3–V4). There were no observable differences between the sample-preservation media, small differences in detected taxa between the DNA extraction kits (mainly concerning Propionibacteriaceae), and large differences in detected taxa between the two primer pairs V1–V2 and V3–V4. This analysis also showed that microbial occurrences and compositions can vary greatly from toilets to sinks to showers and across wards and hospitals. In surgical wards, patient toilets appeared to be characterized by lower species richness and diversity than staff toilets. Which sampling sites are the best for which assessments should be analyzed in more depth. The fact that the sample processing methods we investigated (apart from the choice of primers) seem to have changed the results only slightly suggests that comparing hospital microbiome studies is a realistic option. The observed differences in species richness and diversity between patient and staff toilets should be further investigated, as these, if confirmed, could be a result of excreted antimicrobials.
The Concordia Research Station provides a unique location for preparatory activities for future human journey to Mars, to explore microbial diversity at subzero temperatures, and monitor the dissemination of human-associated microorganisms within the pristine surrounding environment. Amplicon sequencing was leveraged to investigate the microbial diversity of surface snow samples collected monthly over a two-year period, at three distances from the Station (10, 500, and 1000 m). Even when the extracted total DNA was below the detection limit, 16S rRNA gene sequencing was successfully performed on all samples, while 18S rRNA was amplified on 19 samples out of 51. No significant relationships were observed between microbial diversity and seasonality (summer or winter) or distance from the Concordia base. This suggested that if present, the anthropogenic impact should have been below the detectable limit. While harboring low microbial diversity, the surface snow samples were characterized by heterogeneous microbiomes. Ultimately, our study corroborated the use of DNA sequencing-based techniques for revealing microbial presence in remote and hostile environments, with implications for Planetary Protection during space missions and for life-detection in astrobiology relevant targets.
Bonding wires made of aluminum are the most used materials for the transmission of electrical signals in power electronic devices. During operation, different cyclic mechanical and thermal stresses can lead to fatigue loads and a failure of the bonding wires. A prediction or prevention of the wire failure is not yet possible by design for all cases. The following work presents meaningful fatigue tests in small wire dimensions and investigates the influence of the R-ratio on the lifetime of two different aluminum wires with a diameter of 300 μm each. The experiments show very reproducible fatigue results with ductile failure behavior. The endurable stress amplitude decreases linearly with an increasing stress ratio, which can be displayed by a Smith diagram, even though the applied maximum stresses exceed the initial yield stresses determined by tensile tests. A scaling of the fatigue results by the tensile strength indicates that the fatigue level is significantly influenced by the strength of the material. Due to the very consistent findings, the development of a generalized fatigue model for predicting the lifetime of bonding wires with an arbitrary loading situation seems to be possible and will be further investigated.
Modeling of Creep Behavior of Particulate Composites with Focus on Interfacial Adhesion Effect
(2022)
Evaluation of creep compliance of particulate composites using empirical models always provides parameters depending on initial stress and material composition. The effort spent to connect model parameters with physical properties has not resulted in success yet. Further, during the creep, delamination between matrix and filler may occur depending on time and initial stress, reducing an interface adhesion and load transfer to filler particles. In this paper, the creep compliance curves of glass beads reinforced poly(butylene terephthalate) composites were fitted with Burgers and Findley models providing different sets of time-dependent model parameters for each initial stress. Despite the finding that the Findley model performs well in a primary creep, the Burgers model is more suitable if secondary creep comes into play; they allow only for a qualitative prediction of creep behavior because the interface adhesion and its time dependency is an implicit, hidden parameter. As Young’s modulus is a parameter of these models (and the majority of other creep models), it was selected to be introduced as a filler content-dependent parameter with the help of the cube in cube elementary volume approach of Paul. The analysis led to the time-dependent creep compliance that depends only on the time-dependent creep of the matrix and the normalized particle distance (or the filler volume content), and it allowed accounting for the adhesion effect. Comparison with the experimental data confirmed that the elementary volume-based creep compliance function can be used to predict the realistic creep behavior of particulate composites.
Silicon carbide and graphene possess extraordinary chemical and physical properties. Here, these different systems are linked and the changes in structural and dynamic properties are investigated. For the simulations performed a classical molecular dynamic (MD) approach was used. In this approach, a graphene layer (N = 240 atoms) was grafted at different distances on top of a 6H-SiC structure (N = 2400 atoms) and onto a 3C-SiC structure (N = 1728 atoms). The distances between the graphene and the 6H are 1.0, 1.3 and 1.5 Å and the distances between the graphene layer and the 3C-SiC are 2.0, 2.3, and 2.5 Å. Each system has been equilibrated at room temperature until no further relaxation was observed. The 6H-SiC structure in combination with graphene proves to be more stable compared to the combination with 3C-SiC. This can be seen well in the determined energies. Pair distribution functions were influenced slightly by the graphene layer due to steric and energetic changes. This becomes clear from the small shifts of the C-C distances. Interactions as well as bonds between graphene and SiC lead to the fact that small shoulders of the high-frequency SiC-peaks are visible in the spectra and at the same time the high-frequency peaks of graphene are completely absent.
The cystic fibrosis transmembrane conductance regulator (CFTR) anion channel and the epithelial Na+ channel (ENaC) play essential roles in transepithelial ion and fluid transport in numerous epithelial tissues. Inhibitors of both channels have been important tools for defining their physiological role in vitro. However, two commonly used CFTR inhibitors, CFTRinh-172 and GlyH-101, also inhibit non-CFTR anion channels, indicating they are not CFTR specific. However, the potential off-target effects of these inhibitors on epithelial cation channels has to date not been addressed. Here, we show that both CFTR blockers, at concentrations routinely employed by many researchers, caused a significant inhibition of store-operated calcium entry (SOCE) that was time-dependent, poorly reversible and independent of CFTR. Patch clamp experiments showed that both CFTRinh-172 and GlyH-101 caused a significant block of Orai1-mediated whole cell currents, establishing that they likely reduce SOCE via modulation of this Ca2+ release-activated Ca2+ (CRAC) channel. In addition to off-target effects on calcium channels, both inhibitors significantly reduced human αβγ-ENaC-mediated currents after heterologous expression in Xenopus oocytes, but had differential effects on δβγ-ENaC function. Molecular docking identified two putative binding sites in the extracellular domain of ENaC for both CFTR blockers. Together, our results indicate that caution is needed when using these two CFTR inhibitors to dissect the role of CFTR, and potentially ENaC, in physiological processes.
SLC6A14 (ATB0,+) is unique among SLC proteins in its ability to transport 18 of the 20 proteinogenic (dipolar and cationic) amino acids and naturally occurring and synthetic analogues (including anti-viral prodrugs and nitric oxide synthase (NOS) inhibitors). SLC6A14 mediates amino acid uptake in multiple cell types where increased expression is associated with pathophysiological conditions including some cancers. Here, we investigated how a key position within the core LeuT-fold structure of SLC6A14 influences substrate specificity. Homology modelling and sequence analysis identified the transmembrane domain 3 residue V128 as equivalent to a position known to influence substrate specificity in distantly related SLC36 and SLC38 amino acid transporters. SLC6A14, with and without V128 mutations, was heterologously expressed and function determined by radiotracer solute uptake and electrophysiological measurement of transporter-associated current. Substituting the amino acid residue occupying the SLC6A14 128 position modified the binding pocket environment and selectively disrupted transport of cationic (but not dipolar) amino acids and related NOS inhibitors. By understanding the molecular basis of amino acid transporter substrate specificity we can improve knowledge of how this multi-functional transporter can be targeted and how the LeuT-fold facilitates such diversity in function among the SLC6 family and other SLC amino acid transporters.
The following work presents algorithms for semi-automatic validation, feature extraction and ranking of time series measurements acquired from MOX gas sensors. Semi-automatic measurement validation is accomplished by extending established curve similarity algorithms with a slope-based signature calculation. Furthermore, a feature-based ranking metric is introduced. It allows for individual prioritization of each feature and can be used to find the best performing sensors regarding multiple research questions. Finally, the functionality of the algorithms, as well as the developed software suite, are demonstrated with an exemplary scenario, illustrating how to find the most power-efficient MOX gas sensor in a data set collected during an extensive screening consisting of 16,320 measurements, all taken with different sensors at various temperatures and analytes.
A precise characterization of substances is essential for the safe handling of explosives. One parameter regularly characterized is the impact sensitivity. This is typically determined using a drop hammer. However, the results can vary depending on the test method and even the operator, and it is not possible to distinguish the type of decomposition such as detonation and deflagration. This study monitors the reaction progress by constructing a drop hammer to measure the decomposition reaction of four different primary explosives (tetrazene, silver azide, lead azide, lead styphnate) in order to determine the reproducibility of this method. Additionally, further possible evaluation methods are explored to improve on the current binary statistical analysis. To determine whether classification was possible based on extracted features, the responses of equipped sensor arrays, which measure and monitor the reactions, were studied and evaluated. Features were extracted from this data and were evaluated using multivariate methods such as principal component analysis (PCA) and linear discriminant analysis (LDA). The results indicate that although the measurements show substance specific trends, they also show a large scatter for each substance. By reducing the dimensions of the extracted features, different sample clusters can be represented and the calculated loadings allow significant parameters to be determined for classification. The results also suggest that differentiation of different reaction mechanisms is feasible. Testing of the regressor function shows reliable results considering the comparatively small amount of data.
Cytokine-induced killer cells (CIK) in combination with dendritic cells (DCs) have shown favorable outcomes in renal cell carcinoma (RCC), yet some patients exhibit recurrence or no response to this therapy. In a broader perspective, enhancing the antitumor response of DC-CIK cells may help to address this issue. Considering this, herein, we investigated the effect of anti-CD40 and anti-CTLA-4 antibodies on the antitumor response of DC-CIK cells against RCC cell lines. Our analysis showed that, a) anti-CD40 antibody (G28.5) increased the CD3+CD56+ effector cells of CIK cells by promoting the maturation and activation of DCs, b) G28.5 also increased CTLA-4 expression in CIK cells via DCs, but the increase could be hindered by the CTLA-4 inhibitor (ipilimumab), c) adding ipilimumab was also able to significantly increase the proportion of CD3+CD56+ cells in DC-CIK cells, d) anti-CD40 antibodies predominated over anti-CTLA-4 antibodies for cytotoxicity, apoptotic effect and IFN-g secretion of DC-CIK cells against RCC cells, e) after ipilimumab treatment, the population of Tregs in CIK cells remained unaffected, but ipilimumab combined with G28.5 significantly reduced the expression of CD28 in CIK cells. Taken together, we suggest that the agonistic anti-CD40 antibody rather than CTLA-4 inhibitor may improve the antitumor response of DC-CIK cells, particularly in RCC. In addition, we pointed towards the yet to be known contribution of CD28 in the crosstalk between anti-CTLA-4 and CIK cells.
While many proteins are known clients of heat shock protein 90 (Hsp90), it is unclear whether the transcription factor, thyroid hormone receptor beta (TRb), interacts with Hsp90 to control hormonal perception and signaling. Higher Hsp90 expression in mouse fibroblasts was elicited by the addition of triiodothyronine (T3). T3 bound to Hsp90 and enhanced adenosine triphosphate (ATP) binding of Hsp90 due to a specific binding site for T3, as identified by molecular docking experiments. The binding of TRb to Hsp90 was prevented by T3 or by the thyroid mimetic sobetirome. Purified recombinant TRb trapped Hsp90 from cell lysate or purified Hsp90 in pull-down experiments. The affinity of Hsp90 for TRb was 124 nM. Furthermore, T3 induced the release of bound TRb from Hsp90, which was shown by streptavidin-conjugated quantum dot (SAv-QD) masking assay. The data indicate that the T3 interaction with TRb and Hsp90 may be an amplifier of the cellular stress response by blocking Hsp90 activity.
Approximately 45% of global greenhouse gas emissions are caused by the construction and use of buildings. Thermal insulation of buildings in the current context of climate change is a well-known strategy to improve the energy efficiency of buildings. The development of renewable insulation material can overcome the drawbacks of widely used insulation systems based on polystyrene or mineral wool. This study analyzes the sustainability and thermal conductivity of new insulation materials made of Miscanthus x giganteus fibers, foaming agents, and alkali-activated fly ash binder. Life cycle assessments (LCA) are necessary to perform benchmarking of environmental impacts of new formulations of geopolymer-based insulation materials. The global warming potential (GWP) of the product is primarily determined by the main binder component sodium silicate. Sodium silicate's CO2 emissions depend on local production, transportation, and energy consumption. The results, which have been published during recent years, vary in a wide range from 0.3 kg to 3.3 kg CO2-eq. kg-1. The overall GWP of the insulation system based on Miscanthus fibers, with properties according to current thermal insulation regulations, reaches up to 95% savings of CO2 emissions compared to conventional systems. Carbon neutrality can be achieved through formulations containing raw materials with carbon dioxide emissions and renewable materials with negative GWP, thus balancing CO2 emissions.
Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC50 of 50 μM. The binding motif can influence the activity of Hsp90 by hindering ATP accessibility or the release of ADP.