Refine
H-BRS Bibliography
- yes (138)
Departments, institutes and facilities
- Fachbereich Angewandte Naturwissenschaften (33)
- Fachbereich Wirtschaftswissenschaften (31)
- Fachbereich Ingenieurwissenschaften und Kommunikation (26)
- Fachbereich Informatik (22)
- Institut für Technik, Ressourcenschonung und Energieeffizienz (TREE) (22)
- Internationales Zentrum für Nachhaltige Entwicklung (IZNE) (16)
- Institut für Medienentwicklung und -analyse (IMEA) (10)
- Institut für funktionale Gen-Analytik (IFGA) (10)
- Fachbereich Sozialpolitik und Soziale Sicherung (9)
- Institut für Sicherheitsforschung (ISF) (7)
Document Type
- Article (88)
- Part of a Book (18)
- Conference Object (13)
- Bachelor Thesis (5)
- Report (4)
- Part of Periodical (3)
- Working Paper (3)
- Book review (2)
- Book (monograph, edited volume) (1)
- Master's Thesis (1)
Year of publication
- 2022 (138) (remove)
Has Fulltext
- yes (138) (remove)
Keywords
- Knowledge Graphs (3)
- Machine Learning (3)
- Well-being (3)
- relaxation (3)
- Agil (2)
- Agilität (2)
- Bioinformatics (2)
- IT-Controlling (2)
- IT-Projektmanagement (2)
- Kanban (2)
Auswirkungen einer anhaltenden, inflationären Geldpolitik in der Eurozone auf den privaten Sparer
(2022)
Die vorliegende Bachelorarbeit setzt sich kritisch mit den Auswirkungen einer anhaltenden, inflationären Geldpolitik in der Eurozone auf den privaten Sparer auseinander. Im Rahmen dieser Arbeit wird aufgezeigt, wie die starke Erhöhung der Geldmenge Einfluss auf die Möglichkeiten und Entscheidungen des Sparers hat und wie weit eine solche Geldpolitik mit den Interessen des Sparers vereinbar ist.
Jahresbericht 2021
(2022)
In Forschung, Lehre und Transfer neue Wege beschreiten und Akzente setzen – das hat die Hochschule Bonn-Rhein-Sieg (H-BRS) im vergangenen Jahr trotz der Corona-Pandemie geschafft. Talente, Ideen und Kooperationen sind in unterschiedlicher Weise zur Geltung gekommen, stets im engen Austausch zwischen angewandter Wissenschaft, Gesellschaft und Wirtschaft. „Entfalten“ lautet deshalb das Motto des Jahresberichts der H-BRS für das Jahr 2021, der jetzt erschienen ist.
The white ground crater by the Phiale Painter (450–440 BC) exhibited in the “Pietro Griffo” Archaeological Museum in Agrigento (Italy) depicts two scenes from Perseus myth. The vase is of utmost importance to archaeologists because the figures are drawn on a white background with remarkable daintiness and attention to detail. Notwithstanding the white ground ceramics being well documented from an archaeological and historical point of view, doubts concerning the compositions of pigments and binders and the production technique are still unsolved. This kind of vase is a valuable rarity, the use of which is documented in elitist funeral rituals. The study aims to investigate the constituent materials and the execution technique of this magnificent crater. The investigation was carried out using non-destructive and non-invasive techniques in situ. Portable X-ray fluorescence and Fourier-transform total reflection infrared spectroscopy complemented the use of visible and ultraviolet light photography to get an overview and specific information on the vase. The XRF data were used to produce false colour maps showing the location of the various elements detected, using the program SmART_scan. The use of gypsum as the material for the white ground is an important result that deserves to be further investigated in similar vases.
Comparative study of 3D object detection frameworks based on LiDAR data and sensor fusion techniques
(2022)
Estimating and understanding the surroundings of the vehicle precisely forms the basic and crucial step for the autonomous vehicle. The perception system plays a significant role in providing an accurate interpretation of a vehicle's environment in real-time. Generally, the perception system involves various subsystems such as localization, obstacle (static and dynamic) detection, and avoidance, mapping systems, and others. For perceiving the environment, these vehicles will be equipped with various exteroceptive (both passive and active) sensors in particular cameras, Radars, LiDARs, and others. These systems are equipped with deep learning techniques that transform the huge amount of data from the sensors into semantic information on which the object detection and localization tasks are performed. For numerous driving tasks, to provide accurate results, the location and depth information of a particular object is necessary. 3D object detection methods, by utilizing the additional pose data from the sensors such as LiDARs, stereo cameras, provides information on the size and location of the object. Based on recent research, 3D object detection frameworks performing object detection and localization on LiDAR data and sensor fusion techniques show significant improvement in their performance. In this work, a comparative study of the effect of using LiDAR data for object detection frameworks and the performance improvement seen by using sensor fusion techniques are performed. Along with discussing various state-of-the-art methods in both the cases, performing experimental analysis, and providing future research directions.
Breaking new ground and setting new trends in research, teaching and transfer - this is what the Hochschule Bonn-Rhein-Sieg (H-BRS) managed to do last year despite the Corona pandemic. Talents, ideas and cooperations have come to fruition in various ways, always in close exchange between applied science, society and business. "expand" is therefore the motto of the annual report of the H-BRS for the year 2021, which has now been published.
Recent advances in Natural Language Processing have substantially improved contextualized representations of language. However, the inclusion of factual knowledge, particularly in the biomedical domain, remains challenging. Hence, many Language Models (LMs) are extended by Knowledge Graphs (KGs), but most approaches require entity linking (i.e., explicit alignment between text and KG entities). Inspired by single-stream multimodal Transformers operating on text, image and video data, this thesis proposes the Sophisticated Transformer trained on biomedical text and Knowledge Graphs (STonKGs). STonKGs incorporates a novel multimodal architecture based on a cross encoder that uses the attention mechanism on a concatenation of input sequences derived from text and KG triples, respectively. Over 13 million so-called text-triple pairs, coming from PubMed and assembled using the Integrated Network and Dynamical Reasoning Assembler (INDRA), were used in an unsupervised pre-training procedure to learn representations of biomedical knowledge in STonKGs. By comparing STonKGs to an NLP- and a KG-baseline (operating on either text or KG data) on a benchmark consisting of eight fine-tuning tasks, the proposed knowledge integration method applied in STonKGs was empirically validated. Specifically, on tasks with a comparatively small dataset size and a larger number of classes, STonKGs resulted in considerable performance gains, beating the F1-score of the best baseline by up to 0.083. Both the source code as well as the code used to implement STonKGs are made publicly available so that the proposed method of this thesis can be extended to many other biomedical applications.
Contextual information is widely considered for NLP and knowledge discovery in life sciences since it highly influences the exact meaning of natural language. The scientific challenge is not only to extract such context data, but also to store this data for further query and discovery approaches. Classical approaches use RDF triple stores, which have serious limitations. Here, we propose a multiple step knowledge graph approach using labeled property graphs based on polyglot persistence systems to utilize context data for context mining, graph queries, knowledge discovery and extraction. We introduce the graph-theoretic foundation for a general context concept within semantic networks and show a proof of concept based on biomedical literature and text mining. Our test system contains a knowledge graph derived from the entirety of PubMed and SCAIView data and is enriched with text mining data and domain-specific language data using Biological Expression Language. Here, context is a more general concept than annotations. This dense graph has more than 71M nodes and 850M relationships. We discuss the impact of this novel approach with 27 real-world use cases represented by graph queries. Storing and querying a giant knowledge graph as a labeled property graph is still a technological challenge. Here, we demonstrate how our data model is able to support the understanding and interpretation of biomedical data. We present several real-world use cases that utilize our massive, generated knowledge graph derived from PubMed data and enriched with additional contextual data. Finally, we show a working example in context of biologically relevant information using SCAIView.
For research in audiovisual interview archives often it is not only of interest what is said but also how. Sentiment analysis and emotion recognition can help capture, categorize and make these different facets searchable. In particular, for oral history archives, such indexing technologies can be of great interest. These technologies can help understand the role of emotions in historical remembering. However, humans often perceive sentiments and emotions ambiguously and subjectively. Moreover, oral history interviews have multi-layered levels of complex, sometimes contradictory, sometimes very subtle facets of emotions. Therefore, the question arises of the chance machines and humans have capturing and assigning these into predefined categories. This paper investigates the ambiguity in human perception of emotions and sentiment in German oral history interviews and the impact on machine learning systems. Our experiments reveal substantial differences in human perception for different emotions. Furthermore, we report from ongoing machine learning experiments with different modalities. We show that the human perceptual ambiguity and other challenges, such as class imbalance and lack of training data, currently limit the opportunities of these technologies for oral history archives. Nonetheless, our work uncovers promising observations and possibilities for further research.
ProtSTonKGs: A Sophisticated Transformer Trained on Protein Sequences, Text, and Knowledge Graphs
(2022)
While most approaches individually exploit unstructured data from the biomedical literature or structured data from biomedical knowledge graphs, their union can better exploit the advantages of such approaches, ultimately improving representations of biology. Using multimodal transformers for such purposes can improve performance on context dependent classication tasks, as demonstrated by our previous model, the Sophisticated Transformer Trained on Biomedical Text and Knowledge Graphs (STonKGs). In this work, we introduce ProtSTonKGs, a transformer aimed at learning all-encompassing representations of protein-protein interactions. ProtSTonKGs presents an extension to our previous work by adding textual protein descriptions and amino acid sequences (i.e., structural information) to the text- and knowledge graph-based input sequence used in STonKGs. We benchmark ProtSTonKGs against STonKGs, resulting in improved F1 scores by up to 0.066 (i.e., from 0.204 to 0.270) in several tasks such as predicting protein interactions in several contexts. Our work demonstrates how multimodal transformers can be used to integrate heterogeneous sources of information, paving the foundation for future approaches that use multiple modalities for biomedical applications.
Due to the COVID-19 pandemic, health education programs and workplace health promotion (WHP) could only be offered under difficult conditions, if at all. In Germany for example, mandatory lockdowns, working from home, and physical distancing have led to a sharp decline in expenditure on prevention and health promotion from 2019 to 2020. At the same time, the pandemic has negatively affected many people’s mental health. Therefore, our goal was to examine audiovisual stimulation as a possible measure in the context of WHP, because its usage is contact-free, time flexible, and offers, additionally, voice-guided health education programs. In an online survey following a cross-sectional single case study design with 393 study participants, we examined the associations between audiovisual stimulation and mental health, work engagement, and burnout. Using multiple regression analyses, we could identify positive associations between audiovisual stimulation and mental health, burnout, and work engagement. However, longitudinal data are needed to further investigate causal mechanisms between mental health and the use of audiovisual stimulation. Nevertheless, especially with regard to the pandemic, audiovisual stimulation may represent a promising measure for improving mental health at the workplace.
Effective Neighborhood Feature Exploitation in Graph CNNs for Point Cloud Object-Part Segmentation
(2022)
Part segmentation is the task of semantic segmentation applied on objects and carries a wide range of applications from robotic manipulation to medical imaging. This work deals with the problem of part segmentation on raw, unordered point clouds of 3D objects. While pioneering works on deep learning for point clouds typically ignore taking advantage of local geometric structure around individual points, the subsequent methods proposed to extract features by exploiting local geometry have not yielded significant improvements either. In order to investigate further, a graph convolutional network (GCN) is used in this work in an attempt to increase the effectiveness of such neighborhood feature exploitation approaches. Most of the previous works also focus only on segmenting complete point cloud data. Considering the impracticality of such approaches, taking into consideration the real world scenarios where complete point clouds are scarcely available, this work proposes approaches to deal with partial point cloud segmentation.
In the attempt to better capture neighborhood features, this work proposes a novel method to learn regional part descriptors which guide and refine the segmentation predictions. The proposed approach helps the network achieve state-of-the-art performance of 86.4% mIoU on the ShapeNetPart dataset for methods which do not use any preprocessing techniques or voting strategies. In order to better deal with partial point clouds, this work also proposes new strategies to train and test on partial data. While achieving significant improvements compared to the baseline performance, the problem of partial point cloud segmentation is also viewed through an alternate lens of semantic shape completion.
Semantic shape completion networks not only help deal with partial point cloud segmentation but also enrich the information captured by the system by predicting complete point clouds with corresponding semantic labels for each point. To this end, a new network architecture for semantic shape completion is also proposed based on point completion network (PCN) which takes advantage of a graph convolution based hierarchical decoder for completion as well as segmentation. In addition to predicting complete point clouds, results indicate that the network is capable of reaching within a margin of 5% to the mIoU performance of dedicated segmentation networks for partial point cloud segmentation.
As cameras are ubiquitous in autonomous systems, object detection is a crucial task. Object detectors are widely used in applications such as autonomous driving, healthcare, and robotics. Given an image, an object detector outputs both the bounding box coordinates as well as classification probabilities for each object detected. The state-of-the-art detectors are treated as black boxes due to their highly non-linear internal computations. Even with unprecedented advancements in detector performance, the inability to explain how their outputs are generated limits their use in safety-critical applications in particular. It is therefore crucial to explain the reason behind each detector decision in order to gain user trust, enhance detector performance, and analyze their failure.
Previous work fails to explain as well as evaluate both bounding box and classification decisions individually for various detectors. Moreover, no tools explain each detector decision, evaluate the explanations, and also identify the reasons for detector failures. This restricts the flexibility to analyze detectors. The main contribution presented here is an open-source Detector Explanation Toolkit (DExT). It is used to explain the detector decisions, evaluate the explanations, and analyze detector errors. The detector decisions are explained visually by highlighting the image pixels that most influence a particular decision. The toolkit implements the proposed approach to generate a holistic explanation for all detector decisions using certain gradient-based explanation methods. To the author’s knowledge, this is the first work to conduct extensive qualitative and novel quantitative evaluations of different explanation methods across various detectors. The qualitative evaluation incorporates a visual analysis of the explanations carried out by the author as well as a human-centric evaluation. The human-centric evaluation includes a user study to understand user trust in the explanations generated across various explanation methods for different detectors. Four multi-object visualization methods are provided to merge the explanations of multiple objects detected in an image as well as the corresponding detector outputs in a single image. Finally, DExT implements the procedure to analyze detector failures using the formulated approach.
The visual analysis illustrates that the ability to explain a model is more dependent on the model itself than the actual ability of the explanation method. In addition, the explanations are affected by the object explained, the decision explained, detector architecture, training data labels, and model parameters. The results of the quantitative evaluation show that the Single Shot MultiBox Detector (SSD) is more faithfully explained compared to other detectors regardless of the explanation methods. In addition, a single explanation method cannot generate more faithful explanations than other methods for both the bounding box and the classification decision across different detectors. Both the quantitative and human-centric evaluations identify that SmoothGrad with Guided Backpropagation (GBP) provides more trustworthy explanations among selected methods across all detectors. Finally, a convex polygon-based multi-object visualization method provides more human-understandable visualization than other methods.
The author expects that DExT will motivate practitioners to evaluate object detectors from the interpretability perspective by explaining both bounding box and classification decisions.
We describe a systematic approach for rendering time-varying simulation data produced by exa-scale simulations, using GPU workstations. The data sets we focus on use adaptive mesh refinement (AMR) to overcome memory bandwidth limitations by representing interesting regions in space with high detail. Particularly, our focus is on data sets where the AMR hierarchy is fixed and does not change over time. Our study is motivated by the NASA Exajet, a large computational fluid dynamics simulation of a civilian cargo aircraft that consists of 423 simulation time steps, each storing 2.5 GB of data per scalar field, amounting to a total of 4 TB. We present strategies for rendering this time series data set with smooth animation and at interactive rates using current generation GPUs. We start with an unoptimized baseline and step by step extend that to support fast streaming updates. Our approach demonstrates how to push current visualization workstations and modern visualization APIs to their limits to achieve interactive visualization of exa-scale time series data sets.
Trojanized software packages used in software supply chain attacks constitute an emerging threat. Unfortunately, there is still a lack of scalable approaches that allow automated and timely detection of malicious software packages and thus most detections are based on manual labor and expertise. However, it has been observed that most attack campaigns comprise multiple packages that share the same or similar malicious code. We leverage that fact to automatically reproduce manually identified clusters of known malicious packages that have been used in real world attacks, thus, reducing the need for expert knowledge and manual inspection. Our approach, AST Clustering using MCL to mimic Expertise (ACME), yields promising results with a 𝐹1 score of 0.99. Signatures are automatically generated based on characteristic code fragments from clusters and are subsequently used to scan the whole npm registry for unreported malicious packages. We are able to identify and report six malicious packages that have been removed from npm consequentially. Therefore, our approach can support the detection by reducing manual labor and hence may be employed by maintainers of package repositories to detect possible software supply chain attacks through trojanized software packages.
Hydrogen is a versatile energy carrier. When produced with renewable energy by water splitting, it is a carbon neutral alternative to fossil fuels. The industrialization process of this technology is currently dominated by electrolyzers powered by solar or wind energy. For small scale applications, however, more integrated device designs for water splitting using solar energy might optimize hydrogen production due to lower balance of system costs and a smarter thermal management. Such devices offer the opportunity to thermally couple the solar cell and the electrochemical compartment. In this way, heat losses in the absorber can be turned into an efficiency boost for the device via simultaneously enhancing the catalytic performance of the water splitting reactions, cooling the absorber, and decreasing the ohmic losses.[1,2] However,integrated devices (sometimes also referred to as “artificial leaves”), currently suffer from a lower technology readiness level (TRL) than the completely decoupled approach.
Research-Practice-Collaborations Addressing One Health and Urban Transformation. A Case Study
(2022)
One Health is an integrative approach at the interface of humans, animals and the environment, which can be implemented as Research-Practice-Collaboration (RPC) for its interdisciplinarity and intersectoral focus on the co-production of knowledge. To exemplify this, the present commentary shows the example of the Forschungskolleg “One Health and Urban Transformation” funded by the Ministry of Culture and Science of the State Government of Nord Rhine Westphalia in Germany. After analysis, the factors identified for a better implementation of RPC for One Health were the ones that allowed for constant communication and the reduction of power asymmetries between practitioners and academics in the co-production of knowledge. In this light, the training of a new generation of scientists at the boundaries of different disciplines that have mediation skills between academia and practice is an important contribution with great implications for societal change that can aid the further development of RPC.
Schulungen in neun Prozessschritten gestalten! Digitalisierung des Masterfaches „Integrierte Managementsysteme“ im Studiengang „Material Science and Sustainability Methods“ im Fachbereich Naturwissenschaften an der Hochschule Bonn-Rhein-Sieg. Am Beispiel einer jahrelang in Präsenz gelehrten Lehrveranstaltung mit Vorlesungen und seminaristischen Übungen wird gezeigt, wie das Gestalten und Durchführen zur Vermittlung prüfungsrelevanter Kompetenzen auch „online“ gelingt. Das passende „Setting“ des Lehr- und Lernprozesses unter Beachtung von Qualitätskriterien und Handlungsempfehlungen ist für jede Art von Schulung in Universitäten, Behörden, Unternehmen und anderen Organsitationen relevant.
Silicon carbide and graphene possess extraordinary chemical and physical properties. Here, these different systems are linked and the changes in structural and dynamic properties are investigated. For the simulations performed a classical molecular dynamic (MD) approach was used. In this approach, a graphene layer (N = 240 atoms) was grafted at different distances on top of a 6H-SiC structure (N = 2400 atoms) and onto a 3C-SiC structure (N = 1728 atoms). The distances between the graphene and the 6H are 1.0, 1.3 and 1.5 Å and the distances between the graphene layer and the 3C-SiC are 2.0, 2.3, and 2.5 Å. Each system has been equilibrated at room temperature until no further relaxation was observed. The 6H-SiC structure in combination with graphene proves to be more stable compared to the combination with 3C-SiC. This can be seen well in the determined energies. Pair distribution functions were influenced slightly by the graphene layer due to steric and energetic changes. This becomes clear from the small shifts of the C-C distances. Interactions as well as bonds between graphene and SiC lead to the fact that small shoulders of the high-frequency SiC-peaks are visible in the spectra and at the same time the high-frequency peaks of graphene are completely absent.
MOTIVATION
The majority of biomedical knowledge is stored in structured databases or as unstructured text in scientific publications. This vast amount of information has led to numerous machine learning-based biological applications using either text through natural language processing (NLP) or structured data through knowledge graph embedding models (KGEMs). However, representations based on a single modality are inherently limited.
RESULTS
To generate better representations of biological knowledge, we propose STonKGs, a Sophisticated Transformer trained on biomedical text and Knowledge Graphs (KGs). This multimodal Transformer uses combined input sequences of structured information from KGs and unstructured text data from biomedical literature to learn joint representations in a shared embedding space. First, we pre-trained STonKGs on a knowledge base assembled by the Integrated Network and Dynamical Reasoning Assembler (INDRA) consisting of millions of text-triple pairs extracted from biomedical literature by multiple NLP systems. Then, we benchmarked STonKGs against three baseline models trained on either one of the modalities (i.e., text or KG) across eight different classification tasks, each corresponding to a different biological application. Our results demonstrate that STonKGs outperforms both baselines, especially on the more challenging tasks with respect to the number of classes, improving upon the F1-score of the best baseline by up to 0.084 (i.e., from 0.881 to 0.965). Finally, our pre-trained model as well as the model architecture can be adapted to various other transfer learning applications.
AVAILABILITY
We make the source code and the Python package of STonKGs available at GitHub (https://github.com/stonkgs/stonkgs) and PyPI (https://pypi.org/project/stonkgs/). The pre-trained STonKGs models and the task-specific classification models are respectively available at https://huggingface.co/stonkgs/stonkgs-150k and https://zenodo.org/communities/stonkgs.
SUPPLEMENTARY INFORMATION
Supplementary data are available at Bioinformatics online.
Current research in augmented, virtual, and mixed reality (XR) reveals a lack of tool support for designing and, in particular, prototyping XR applications. While recent tools research is often motivated by studying the requirements of non-technical designers and end-user developers, the perspective of industry practitioners is less well understood. In an interview study with 17 practitioners from different industry sectors working on professional XR projects, we establish the design practices in industry, from early project stages to the final product. To better understand XR design challenges, we characterize the different methods and tools used for prototyping and describe the role and use of key prototypes in the different projects. We extract common elements of XR prototyping, elaborating on the tools and materials used for prototyping and establishing different views on the notion of fidelity. Finally, we highlight key issues for future XR tools research.
Modern GPUs come with dedicated hardware to perform ray/triangle intersections and bounding volume hierarchy (BVH) traversal. While the primary use case for this hardware is photorealistic 3D computer graphics, with careful algorithm design scientists can also use this special-purpose hardware to accelerate general-purpose computations such as point containment queries. This article explains the principles behind these techniques and their application to vector field visualization of large simulation data using particle tracing.
BACKGROUND: Humans demonstrate many physiological changes in microgravity for which long-duration head down bed rest (HDBR) is a reliable analog. However, information on how HDBR affects sensory processing is lacking.
OBJECTIVE: We previously showed [25] that microgravity alters the weighting applied to visual cues in determining the perceptual upright (PU), an effect that lasts long after return. Does long-duration HDBR have comparable effects?
METHODS: We assessed static spatial orientation using the luminous line test (subjective visual vertical, SVV) and the oriented character recognition test (PU) before, during and after 21 days of 6° HDBR in 10 participants. Methods were essentially identical as previously used in orbit [25].
RESULTS: Overall, HDBR had no effect on the reliance on visual relative to body cues in determining the PU. However, when considering the three critical time points (pre-bed rest, end of bed rest, and 14 days post-bed rest) there was a significant decrease in reliance on visual relative to body cues, as found in microgravity. The ratio had an average time constant of 7.28 days and returned to pre-bed-rest levels within 14 days. The SVV was unaffected.
CONCLUSIONS: We conclude that bed rest can be a useful analog for the study of the perception of static self-orientation during long-term exposure to microgravity. More detailed work on the precise time course of our effects is needed in both bed rest and microgravity conditions.
Modeling of Creep Behavior of Particulate Composites with Focus on Interfacial Adhesion Effect
(2022)
Evaluation of creep compliance of particulate composites using empirical models always provides parameters depending on initial stress and material composition. The effort spent to connect model parameters with physical properties has not resulted in success yet. Further, during the creep, delamination between matrix and filler may occur depending on time and initial stress, reducing an interface adhesion and load transfer to filler particles. In this paper, the creep compliance curves of glass beads reinforced poly(butylene terephthalate) composites were fitted with Burgers and Findley models providing different sets of time-dependent model parameters for each initial stress. Despite the finding that the Findley model performs well in a primary creep, the Burgers model is more suitable if secondary creep comes into play; they allow only for a qualitative prediction of creep behavior because the interface adhesion and its time dependency is an implicit, hidden parameter. As Young’s modulus is a parameter of these models (and the majority of other creep models), it was selected to be introduced as a filler content-dependent parameter with the help of the cube in cube elementary volume approach of Paul. The analysis led to the time-dependent creep compliance that depends only on the time-dependent creep of the matrix and the normalized particle distance (or the filler volume content), and it allowed accounting for the adhesion effect. Comparison with the experimental data confirmed that the elementary volume-based creep compliance function can be used to predict the realistic creep behavior of particulate composites.
While the recent discussion on Art. 25 GDPR often considers the approach of data protection by design as an innovative idea, the notion of making data protection law more effective through requiring the data controller to implement the legal norms into the processing design is almost as old as the data protection debate. However, there is another, more recent shift in establishing the data protection by design approach through law, which is not yet understood to its fullest extent in the debate. Art. 25 GDPR requires the controller to not only implement the legal norms into the processing design but to do so in an effective manner. By explicitly declaring the effectiveness of the protection measures to be the legally required result, the legislator inevitably raises the question of which methods can be used to test and assure such efficacy. In our opinion, extending the legal compatibility assessment to the real effects of the required measures opens this approach to interdisciplinary methodologies. In this paper, we first summarise the current state of research on the methodology established in Art. 25 sect. 1 GDPR, and pinpoint some of the challenges of incorporating interdisciplinary research methodologies. On this premise, we present an empirical research methodology and first findings which offer one approach to answering the question on how to specify processing purposes effectively. Lastly, we discuss the implications of these findings for the legal interpretation of Art. 25 GDPR and related provisions, especially with respect to a more effective implementation of transparency and consent, and provide an outlook on possible next research steps.
SLC6A14 (ATB0,+) is unique among SLC proteins in its ability to transport 18 of the 20 proteinogenic (dipolar and cationic) amino acids and naturally occurring and synthetic analogues (including anti-viral prodrugs and nitric oxide synthase (NOS) inhibitors). SLC6A14 mediates amino acid uptake in multiple cell types where increased expression is associated with pathophysiological conditions including some cancers. Here, we investigated how a key position within the core LeuT-fold structure of SLC6A14 influences substrate specificity. Homology modelling and sequence analysis identified the transmembrane domain 3 residue V128 as equivalent to a position known to influence substrate specificity in distantly related SLC36 and SLC38 amino acid transporters. SLC6A14, with and without V128 mutations, was heterologously expressed and function determined by radiotracer solute uptake and electrophysiological measurement of transporter-associated current. Substituting the amino acid residue occupying the SLC6A14 128 position modified the binding pocket environment and selectively disrupted transport of cationic (but not dipolar) amino acids and related NOS inhibitors. By understanding the molecular basis of amino acid transporter substrate specificity we can improve knowledge of how this multi-functional transporter can be targeted and how the LeuT-fold facilitates such diversity in function among the SLC6 family and other SLC amino acid transporters.
While many proteins are known clients of heat shock protein 90 (Hsp90), it is unclear whether the transcription factor, thyroid hormone receptor beta (TRb), interacts with Hsp90 to control hormonal perception and signaling. Higher Hsp90 expression in mouse fibroblasts was elicited by the addition of triiodothyronine (T3). T3 bound to Hsp90 and enhanced adenosine triphosphate (ATP) binding of Hsp90 due to a specific binding site for T3, as identified by molecular docking experiments. The binding of TRb to Hsp90 was prevented by T3 or by the thyroid mimetic sobetirome. Purified recombinant TRb trapped Hsp90 from cell lysate or purified Hsp90 in pull-down experiments. The affinity of Hsp90 for TRb was 124 nM. Furthermore, T3 induced the release of bound TRb from Hsp90, which was shown by streptavidin-conjugated quantum dot (SAv-QD) masking assay. The data indicate that the T3 interaction with TRb and Hsp90 may be an amplifier of the cellular stress response by blocking Hsp90 activity.
Due to expected positive impacts on business, the application of artificial intelligence has been widely increased. The decision-making procedures of those models are often complex and not easily understandable to the company’s stakeholders, i.e. the people having to follow up on recommendations or try to understand automated decisions of a system. This opaqueness and black-box nature might hinder adoption, as users struggle to make sense and trust the predictions of AI models. Recent research on eXplainable Artificial Intelligence (XAI) focused mainly on explaining the models to AI experts with the purpose of debugging and improving the performance of the models. In this article, we explore how such systems could be made explainable to the stakeholders. For doing so, we propose a new convolutional neural network (CNN)-based explainable predictive model for product backorder prediction in inventory management. Backorders are orders that customers place for products that are currently not in stock. The company now takes the risk to produce or acquire the backordered products while in the meantime, customers can cancel their orders if that takes too long, leaving the company with unsold items in their inventory. Hence, for their strategic inventory management, companies need to make decisions based on assumptions. Our argument is that these tasks can be improved by offering explanations for AI recommendations. Hence, our research investigates how such explanations could be provided, employing Shapley additive explanations to explain the overall models’ priority in decision-making. Besides that, we introduce locally interpretable surrogate models that can explain any individual prediction of a model. The experimental results demonstrate effectiveness in predicting backorders in terms of standard evaluation metrics and outperform known related works with AUC 0.9489. Our approach demonstrates how current limitations of predictive technologies can be addressed in the business domain.
This paper explores the role of artificial intelligence (AI) in elite sports. We approach the topic from two perspectives. Firstly, we provide a literature based overview of AI success stories in areas other than sports. We identified multiple approaches in the area of Machine Perception, Machine Learning and Modeling, Planning and Optimization as well as Interaction and Intervention, holding a potential for improving training and competition. Secondly, we discover the present status of AI use in elite sports. Therefore, in addition to another literature review, we interviewed leading sports scientist, which are closely connected to the main national service institute for elite sports in their countries. The analysis of this literature review and the interviews show that the most activity is carried out in the methodical categories of signal and image processing. However, projects in the field of modeling & planning have become increasingly popular within the last years. Based on these two perspectives, we extract deficits, issues and opportunities and summarize them in six key challenges faced by the sports analytics community. These challenges include data collection, controllability of an AI by the practitioners and explainability of AI results.
Der technische Fortschritt im Bereich der Erhebung, Speicherung und Verarbeitung von Daten macht es erforderlich, neue Fragen zu sozialverträglichen Datenmärkten aufzuwerfen. So gibt es sowohl eine Tendenz zur vereinfachten Datenteilung als auch die Forderung, die informationelle Selbstbestimmung besser zu schützen. Innerhalb dieses Spannungsfeldes bewegt sich die Idee von Datentreuhändern. Ziel des Beitrags ist darzulegen, dass zwischen verschiedenen Formen der Datentreuhänderschaft unterschieden werden sollte, um der Komplexität des Themas gerecht zu werden. Insbesondere bedarf es neben der mehrseitigen Treuhänderschaft, mit dem Treuhänder als neutraler Instanz, auch der einseitigen Treuhänderschaft, bei dem der Treuhänder als Anwalt der Verbraucherinteressen fungiert. Aus dieser Perspektive wird das Modell der Datentreuhänderschaft als stellvertretende Deutung der Interessen individueller und kollektiver Identitäten systematisch entwickelt.
The backdated research dedicated to digital entrepreneurship education is immense, which makes it difficult to create an overview. Conversely, forward-thinking bibliometric visualization mapping and clustering can assist in visualizing and structuring difficult research literature. Hence, the goal of this mapping visualization study is to thoroughly discover and create clusters of EE to convey a taxonomic structure that can oblige as a basis for upcoming research. The analyzed data, which is drawn from Google Scholar through Publish or Perish tool, contain 1000 documents published between 2007 and 2022. This taxonomy should generate stronger bonds with digital entrepreneurial education research; on the other, it should stand in international research association to boost both interdisciplinary digital entrepreneurial education and its influence on a universal basis. This work strengthens student’s understanding of current digital entrepreneurial education research by classifying and decontaminating the most powerful knowledgeable relationship among its contributions and contributors. The bibliographic analysis includes ‘citation network’, ‘author’s research area’ and ‘paper content’ regarding the desired topic. In this paper, the above three mentioned terms are integrated which produces a bibliographic model of authors, titles of their papers, keywords and abstract by using Harzing’s Publish or Perish tool for extracting data from Google Scholar and further using VOSViewer to visualize networking map of co-authorship and term co-occurrence to administer the data for an instinctive and appropriate understanding of university students concerning ‘digital entrepreneurial intention’ research. This paper uses bibliometric analysis to analyze the keyword co-occurrence and co-authorship and VOSViewer is used for visualization.
Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC50 of 50 μM. The binding motif can influence the activity of Hsp90 by hindering ATP accessibility or the release of ADP.
Cathepsin K (CatK) is a target for the treatment of osteoporosis, arthritis, and bone metastasis. Peptidomimetics with a cyanohydrazide warhead represent a new class of highly potent CatK inhibitors; however, their binding mechanism is unknown. We investigated two model cyanohydrazide inhibitors with differently positioned warheads: an azadipeptide nitrile Gü1303 and a 3-cyano-3-aza-β-amino acid Gü2602. Crystal structures of their covalent complexes were determined with mature CatK as well as a zymogen-like activation intermediate of CatK. Binding mode analysis, together with quantum chemical calculations, revealed that the extraordinary picomolar potency of Gü2602 is entropically favoured by its conformational flexibility at the nonprimed-primed subsites boundary. Furthermore, we demonstrated by live cell imaging that cyanohydrazides effectively target mature CatK in osteosarcoma cells. Cyanohydrazides also suppressed the maturation of CatK by inhibiting the autoactivation of the CatK zymogen. Our results provide structural insights for the rational design of cyanohydrazide inhibitors of CatK as potential drugs.
There is an unmet need for the development and validation of biomarkers and surrogate endpoints for clinical trials in propionic acidemia (PA) and methylmalonic acidemia (MMA). This review examines the pathophysiology and clinical consequences of PA and MMA that could form the basis for potential biomarkers and surrogate endpoints. Changes in primary metabolites such as methylcitric acid (MCA), MCA:citric acid ratio, oxidation of 13C-propionate (exhaled 13CO2), and propionylcarnitine (C3) have demonstrated clinical relevance in patients with PA or MMA. Methylmalonic acid, another primary metabolite, is a potential biomarker, but only in patients with MMA. Other potential biomarkers in patients with either PA and MMA include secondary metabolites, such as ammonium, or the mitochondrial disease marker, fibroblast growth factor 21. Additional research is needed to validate these biomarkers as surrogate endpoints, and to determine whether other metabolites or markers of organ damage could also be useful biomarkers for clinical trials of investigational drug treatments in patients with PA or MMA. This review examines the evidence supporting a variety of possible biomarkers for drug development in propionic and methylmalonic acidemias.
The epithelial sodium channel (ENaC) is a heterotrimeric ion channel that plays a key role in sodium and water homeostasis in tetrapod vertebrates. In the aldosterone-sensitive distal nephron, hormonally controlled ENaC expression matches dietary sodium intake to its excretion. Furthermore, ENaC mediates sodium absorption across the epithelia of the colon, sweat ducts, reproductive tract, and lung. ENaC is a constitutively active ion channel and its expression, membrane abundance, and open probability (PO) are controlled by multiple intracellular and extracellular mediators and mechanisms [9]. Aberrant ENaC regulation is associated with severe human diseases, including hypertension, cystic fibrosis, pulmonary edema, pseudohypoaldosteronism type 1, and nephrotic syndrome [9].
The implementation of the Sustainable Development Goals (SDGs) and the conservation and protection of nature are among the greatest challenges facing urban regions. There are few approaches so far that link the SDGs to natural diversity and related ecosystem services at the local level and track them in terms of increasing sustainable development at the local level. We want to close this gap by developing a set of indicators that capture ecosystem services in the sense of the SDGs and which are based on data that are freely available throughout Germany and Europe. Based on 10 SDGs and 35 SDG indicators, we are developing an ecosystem service and biodiversity-related indicator set for the evaluation of sustainable development in urban areas. We further show that it is possible to close many of the data gaps between SDGs and locally collected data mentioned in the literature and to translate the universal SDGs to the local level. Our example develops this set of indicators for the Bonn/Rhein-Sieg metropolitan area in North Rhine-Westphalia, Germany, which comprises both rural and densely populated settlements. This set of indicators can also help improve communication and plan sustainable development by increasing transparency in local sustainability, implementing a visible sustainability monitoring system, and strengthening the collaboration between local stakeholders.
Education for Sustainable Development (ESD, SDG 4) and human well-being (SDG 3) are among the central subjects of the Sustainable Development Goals (SDGs). In this article, based on the Questionnaire for Eudaimonic Well-Being (QEWB), we investigate to what extent (a) there is a connection between EWB and practical commitment to the SDGs and whether (b) there is a deficit in EWB among young people in general. We also want to use the article to draw attention to the need for further research on the links between human well-being and commitment for sustainable development. A total of 114 students between the ages of 18 and 34, who are either engaged in (extra)curricular activities of sustainable development (28 students) or not (86 students), completed the QEWB. The students were interviewed twice: once regarding their current and their aspired EWB. Our results show that students who are actively engaged in activities for sustainable development report a higher EWB than non-active students. Furthermore, we show that students generally report deficits in EWB and wish for an improvement in their well-being. This especially applies to aspects of EWB related to self-discovery and the sense of meaning in life. Our study suggests that a practice-oriented ESD in particular can have a positive effect on the quality of life of young students and can support them in working on deficits in EWB.
Process-induced changes in the morphology of biodegradable polybutylene adipate terephthalate (PBAT) and polylactic acid (PLA) blends modified with various multifunctional chainextending cross-linkers (CECLs) are presented. The morphology of unmodified and modified films produced with blown film extrusion is examined in an extrusion direction (ED) and a transverse direction (TD). While FTIR analysis showed only small peak shifts indicating that the CECLs modify the molecular weight of the PBAT/PLA blend, SEM investigations of the fracture surfaces of blown extrusion films revealed their significant effect on the morphology formed during the processing. Due to the combined shear and elongation deformation during blown film extrusion, rather spherical PLA islands were partly transformed into long fibrils, which tended to decay to chains of elliptical islands if cooled slowly. The CECL introduction into the blend changed the thickness of the PLA fibrils, modified the interface adhesion, and altered the deformation behavior of the PBAT matrix from brittle to ductile. The results proved that CECLs react selectively with PBAT, PLA, and their interface. Furthermore, the reactions of CECLs with PBAT/PLA induced by the processing depended on the deformation directions (ED and TD), thus resulting in further non-uniformities of blown extrusion films.
Seit Sokrates bildet die Frage „Was macht ein glückliches Leben aus?“ den Ausgangspunkt der Entwicklung einer Vielfalt von Wohlbefindenstheorien. Den Kern dieses Aufsatzes bildet die Erörterung der Fragen, inwieweit das Konzept der empirischen Lebenszufriedenheit und die dadurch gewonnenen Korrelate einen Beitrag zur Beantwortung dieser Frage leisten und ob diese Antworten eine Wohlbefindenstheorie begründen können, welche die philosophische Theorie mit empirischen Ergebnissen verknüpft.
Im Zentrum dieses Aufsatzes steht eine Diskussion der wichtigsten Wohlbefindenstheorien, ihrer Qualitäten, Gemeinsamkeiten und Unterschiede. Einen Schwerpunkt bildet die Theorie der subjektiven Lebenszufriedenheit. Ich diskutiere Stärken und Schwächen des Konzeptes und stelle die wichtigsten Ergebnisse der empirischen Lebenszufriedenheitsforschung in einem Überblick dar.
Im Ergebnis argumentiere ich, dass die Resultate der empirischen Forschung als Grundlage einer subjektiv-objektiven Wohlbefindenstheorie dienen können. Qualitativ hochwertige zwischenmenschliche Beziehungen, ein gesunder Lebensstil, eine ausgewogene Work-Life-Balance, der Einsatz für Andere, das Verfolgen von Lebenszielen und persönlichen Interessen bilden die Grundlage einer Wohlbefindenstheorie, die sich auf empirische Lebenszufriedenheitsforschung stützt.
In her recent article, Bender discusses several aspects of research–practice–collaborations (RPCs). In this commentary, we apply Bender's arguments to experiences in engineering research and development (R&D). We investigate the influence of interaction with practice partners on relevance, credibility, and legitimacy in the special engineering field of product development and analyze which methodological approaches are already being pursued for dealing with diverging interests and asymmetries and which steps will be necessary to include interests of civil society beyond traditional customer relations.
The visual and auditory quality of computer-mediated stimuli for virtual and extended reality (VR/XR) is rapidly improving. Still, it remains challenging to provide a fully embodied sensation and awareness of objects surrounding, approaching, or touching us in a 3D environment, though it can greatly aid task performance in a 3D user interface. For example, feedback can provide warning signals for potential collisions (e.g., bumping into an obstacle while navigating) or pinpointing areas where one’s attention should be directed to (e.g., points of interest or danger). These events inform our motor behaviour and are often associated with perception mechanisms associated with our so-called peripersonal and extrapersonal space models that relate our body to object distance, direction, and contact point/impact. We will discuss these references spaces to explain the role of different cues in our motor action responses that underlie 3D interaction tasks. However, providing proximity and collision cues can be challenging. Various full-body vibration systems have been developed that stimulate body parts other than the hands, but can have limitations in their applicability and feasibility due to their cost and effort to operate, as well as hygienic considerations associated with e.g., Covid-19. Informed by results of a prior study using low-frequencies for collision feedback, in this paper we look at an unobtrusive way to provide spatial, proximal and collision cues. Specifically, we assess the potential of foot sole stimulation to provide cues about object direction and relative distance, as well as collision direction and force of impact. Results indicate that in particular vibration-based stimuli could be useful within the frame of peripersonal and extrapersonal space perception that support 3DUI tasks. Current results favor the feedback combination of continuous vibrotactor cues for proximity, and bass-shaker cues for body collision. Results show that users could rather easily judge the different cues at a reasonably high granularity. This granularity may be sufficient to support common navigation tasks in a 3DUI.
In the field of automatic music generation, one of the greatest challenges is the consistent generation of pieces continuously perceived positively by the majority of the audience since there is no objective method to determine the quality of a musical composition. However, composing principles, which have been refined for millennia, have shaped the core characteristics of today's music. A hybrid music generation system, mlmusic, that incorporates various static, music-theory-based methods, as well as data-driven, subsystems, is implemented to automatically generate pieces considered acceptable by the average listener. Initially, a MIDI dataset, consisting of over 100 hand-picked pieces of various styles and complexities, is analysed using basic music theory principles, and the abstracted information is fed into explicitly constrained LSTM networks. For chord progressions, each individual network is specifically trained on a given sequence length, while phrases are created by consecutively predicting the notes' offset, pitch and duration. Using these outputs as a composition's foundation, additional musical elements, along with constrained recurrent rhythmic and tonal patterns, are statically generated. Although no survey regarding the pieces' reception could be carried out, the successful generation of numerous compositions of varying complexities suggests that the integration of these fundamentally distinctive approaches might lead to success in other branches.
Novel methods for contingency analysis of gas transport networks are presented. They are motivated by the transition of our energy system where hydrogen plays a growing role. The novel methods are based on a specific method for topological reduction and so-called supernodes. Stationary Euler equations with advanced compressor thermodynamics and a gas law allowing for gas compositions with up to 100% hydrogen are used. Several measures and plots support an intuitive comparison and analysis of the results. In particular, it is shown that the newly developed methods can estimate locations and magnitudes of additional capacities (injection, buffering, storage etc.) with a reasonable performance for networks of relevant composition and size.
The cube in cube approach was used by Paul and Ishai-Cohen to model and derive formulas for filler content dependent Young's moduli of particle filled composites assuming perfect filler matrix adhesion. Their formulas were chosen because of their simplicity, and recalculated using an elementary volume approach which transforms spherical inclusions to cubic inclusions. The EV approach led to expression of the composites moduli that allows introducing an adhesion factor kadh ranging from 0 and 1 to take into account reduced filler matrix adhesion. This adhesion factor scales the edge length of the cubic inclusions, thus reducing the stress transfer area between matrix and filler. Fitting the experimental data with the modified Paul model provides reasonable kadh for PA66, PBT, PP, PE-LD and BR which are in line with their surface energies. Further analysis showed that stiffening only occurs if kadh exceeds [Formula: see text] and depends on the ratio of matrix modulus and filler modulus. The modified model allows for a quick calculation of any particle filled composites for known matrix modulus EM, filler modulus EF, filler volume content vF and adhesion factor kadh. Thus, finite element analysis (FEA) simulations of any particle filled polymer parts as well as materials selection are significantly eased. FEA of cubic and hexagonal EV arrangements show that stress distributions within the EV exhibit more shear stresses if one deviates from the cubic arrangement. At high filler contents the assumption that the property of the EV is representative for the whole composite, holds only for filler volume contents up to 15 or 20% (corresponding to 30 to 40 weight %). Thus, for vast majority of commercially available particulate composites, the modified model can be applied. Furthermore, this indicates that the cube in cube approach reaches two limits: (i) the occurrence of increasing shear stresses at filler contents above 20% due to deviations of EV arrangements or spatial filler distribution from cubic arrangements (singular), and (ii) increasing interaction between particles with the formation of particle network within the matrix violating the EV assumption of their homogeneous dispersion.
This study investigates the initial stage of the thermo-mechanical crystallization behavior for uni- and biaxially stretched polyethylene. The models are based on a mesoscale molecular dynamics approach. We take constraints that occur in real-life polymer processing into account, especially with respect to the blowing stage of the extrusion blow-molding process. For this purpose, we deform our systems using a wide range of stretching levels before they are quenched. We discuss the effects of the stretching procedures on the micro-mechanical state of the systems, characterized by entanglement behavior and nematic ordering of chain segments. For the cooling stage, we use two different approaches which allow for free or hindered shrinkage, respectively. During cooling, crystallization kinetics are monitored: We precisely evaluate how the interplay of chain length, temperature, local entanglements and orientation of chain segments influence crystallization behavior. Our models reveal that the main stretching direction dominates microscopic states of the different systems. We are able to show that crystallization mainly depends on the (dis-)entanglement behavior. Nematic ordering plays a secondary role.
Die Medikalisierungs- und die Kompressionsthese sind zwei „konkurrierende“ Ansätze in Bezug auf die Frage, in welchem Gesundheitszustand ein längeres Leben, insbesondere die Lebensjahre in höherem Alter verbracht werden. Neben der individuellen Bedeutung von Quantität und Qualität der Lebensjahre ist die Relevanz dieser Frage für das Gesundheitswesen hoch, denn nicht nur in der Vergangenheit ist die Zahl bzw. auch der Anteil der älteren Menschen gestiegen, es wird im Kontext des demografischen Wandels ein weiterer Anstieg, auch der Lebenserwartung, prognostiziert – und die Auswirkungen auf die Versorgungsbedarfe bzw. Ausgaben im Gesundheitswesen können beträchtlich sein.
Emotions are associated with the genesis of visually induced motion sickness in virtual reality
(2022)
Visually induced motion sickness (VIMS) is a well-known side effect of virtual reality (VR) immersion, with symptoms including nausea, disorientation, and oculomotor discomfort. Previous studies have shown that pleasant music, odor, and taste can mitigate VIMS symptomatology, but the mechanism by which this occurs remains unclear. We predicted that positive emotions influence the VIMS-reducing effects. To investigate this, we conducted an experimental study with 68 subjects divided into two groups. The groups were exposed to either positive or neutral emotions before and during the VIMS-provoking stimulus. Otherwise, they performed exactly the same task of estimating the time-to-contact while confronted with a VIMS-provoking moving starfield stimulation. Emotions were induced by means of pre-tested videos and with International Affective Picture System (IAPS) images embedded in the starfield simulation. We monitored emotion induction before, during, and after the simulation, using the Self-Assessment Manikin (SAM) valence and arousal scales. VIMS was assessed before and after exposure using the Simulator Sickness Questionnaire (SSQ) and during simulation using the Fast Motion Sickness Scale (FMS) and FMS-D for dizziness symptoms. VIMS symptomatology did not differ between groups, but valence and arousal were correlated with perceived VIMS symptoms. For instance, reported positive valence prior to VR exposure was found to be related to milder VIMS symptoms and, conversely, experienced symptoms during simulation were negatively related to subjects’ valence. This study sheds light on the complex and potentially bidirectional relationship of VIMS and emotions and provides starting points for further research on the use of positive emotions to prevent VIMS.