Refine
Departments, institutes and facilities
- Fachbereich Angewandte Naturwissenschaften (184)
- Fachbereich Informatik (159)
- Fachbereich Wirtschaftswissenschaften (115)
- Institut für Technik, Ressourcenschonung und Energieeffizienz (TREE) (113)
- Internationales Zentrum für Nachhaltige Entwicklung (IZNE) (82)
- Fachbereich Ingenieurwissenschaften und Kommunikation (81)
- Institut für funktionale Gen-Analytik (IFGA) (72)
- Institute of Visual Computing (IVC) (35)
- Fachbereich Sozialpolitik und Soziale Sicherung (27)
- Institut für Verbraucherinformatik (IVI) (25)
Document Type
- Article (393)
- Conference Object (140)
- Part of a Book (58)
- Report (34)
- Preprint (18)
- Part of Periodical (13)
- Working Paper (13)
- Master's Thesis (8)
- Conference Proceedings (5)
- Book (monograph, edited volume) (2)
Year of publication
Language
- English (685) (remove)
Has Fulltext
- yes (685) (remove)
Keywords
- Entrepreneurship (8)
- Ghana (8)
- cytokine-induced killer cells (7)
- lignin (7)
- Kenya (6)
- Robotik (6)
- Sustainability (6)
- immunotherapy (6)
- GC/MS (5)
- Machine Learning (5)
Our study shows ZP2 to be a new biomarker for diagnosis, best used in combination with other low abundant genes in colon cancer. Furthermore, ZP2 promotes cell proliferation via the ERK1/2-cyclinD1-signaling pathway. We demonstrate that ZP2 mRNA is expressed in a low-abundant manner with high specificity in subsets of cancer cell lines representing different cancer subtypes and also in a significant proportion of primary colon cancers. The potential benefit of ZP2 as a biomarker is discussed. In the second part of our study, the function of ZP2 in cancerogenesis has been analyzed. Since ZP2 shows an enhanced transcript level in colon cancer cells, siRNA experiments have been performed to verify the potential role of ZP2 in cell proliferation. Based on these data, ZP2 might serve as a new target molecule for cancer diagnosis and treatment in respective cancer types such as colon cancer.
YAWL (Yet Another Workflow Language) is an open source Business Process Management System, first released in 2003. YAWL grew out of a university research environment to become a unique system that has been deployed worldwide as a laboratory environment for research in Business Process Management and as a productive system in other scientific domains.
XPERSIF: a software integration framework & architecture for robotic learning by experimentation
(2008)
The integration of independently-developed applications into an efficient system, particularly in a distributed setting, is the core issue addressed in this work. Cooperation between researchers across various field boundaries in order to solve complex problems has become commonplace. Due to the multidisciplinary nature of such efforts, individual applications are developed independent of the integration process. The integration of individual applications into a fully-functioning architecture is a complex and multifaceted task. This thesis extends a component-based architecture, previously developed by the authors, to allow the integration of various software applications which are deployed in a distributed setting. The test bed for the framework is the EU project XPERO, the goal of which is robot learning by experimentation. The task at hand is the integration of the required applications, such as planning of experiments, perception of parametrized features, robot motion control and knowledge-based learning, into a coherent cognitive architecture. This allows a mobile robot to use the methods involved in experimentation in order to learn about its environment. To meet the challenge of developing this architecture within a distributed, heterogeneous environment, the authors specified, defined, developed, implemented and tested a component-based architecture called XPERSIF. The architecture comprises loosely-coupled, autonomous components that offer services through their well-defined interfaces and form a service-oriented architecture. The Ice middleware is used in the communication layer. Its deployment facilitates the necessary refactoring of concepts. One fully specified and detailed use case is the successful integration of the XPERSim simulator which constitutes one of the kernel components of XPERO.The results of this work demonstrate that the proposed architecture is robust and flexible, and can be successfully scaled to allow the complete integration of the necessary applications, thus enabling robot learning by experimentation. The design supports composability, thus allowing components to be grouped together in order to provide an aggregate service. Distributed simulation enabled real time tele-observation of the simulated experiment. Results show that incorporating the XPERSim simulator has substantially enhanced the speed of research and the information flow within the cognitive learning loop.
XML Signature Wrapping (XSW) has been a relevant threat to web services for 15 years until today. Using the Personal Health Record (PHR), which is currently under development in Germany, we investigate a current SOAP-based web services system as a case study. In doing so, we highlight several deficiencies in defending against XSW. Using this real-world contemporary example as motivation, we introduce a guideline for more secure XML signature processing that provides practitioners with easier access to the effective countermeasures identified in the current state of research.
Evaluation is of crucial importance and should meet professional standards in its design. In practice, organizational peculiarities and available resources characterize the search for the "right" approach. When used as a quality development tool, internal or self-evaluation should primarily be useful. It should generate information to answer organizational questions and provide results as a basis for discussion in decision-making processes.
This study contributes to the growing body of research concerning management consultancies by linking two previously disparate fields of study: (1) the examination of the effectiveness of consulting interventions and (2) the examination of the social processes that aim to create and legitimize the insights, knowledge and capabilities of management consultancies. We propose that consulting firms accumulate social authority in the course of pre-intervention discourse processes that is reflected in their reputation and celebrity. With respect to intervention, this social authority affects change recipients’ commitment to and compliance with the requirements of change implementation. We test the proposed relationships by conducting a measured variable path analysis of 117 change initiatives in German companies that were set up and implemented with the assistance of external consultancies. Our findings indicate that a consulting firm’s levels of both celebrity and reputation affect the change recipients’ commitment to proposed change strategies and thus, indirectly affect their behavioral compliance with the explicit requirements of change implementation.
Risk-based authentication (RBA) aims to strengthen password-based authentication rather than replacing it. RBA does this by monitoring and recording additional features during the login process. If feature values at login time differ significantly from those observed before, RBA requests an additional proof of identification. Although RBA is recommended in the NIST digital identity guidelines, it has so far been used almost exclusively by major online services. This is partly due to a lack of open knowledge and implementations that would allow any service provider to roll out RBA protection to its users. To close this gap, we provide a first in-depth analysis of RBA characteristics in a practical deployment. We observed N=780 users with 247 unique features on a real-world online service for over 1.8 years. Based on our collected data set, we provide (i) a behavior analysis of two RBA implementations that were apparently used by major online services in the wild, (ii) a benchmark of the features to extract a subset that is most suitable for RBA use, (iii) a new feature that has not been used in RBA before, and (iv) factors which have a significant effect on RBA performance. Our results show that RBA needs to be carefully tailored to each online service, as even small configuration adjustments can greatly impact RBA's security and usability properties. We provide insights on the selection of features, their weightings, and the risk classification in order to benefit from RBA after a minimum number of login attempts.
Risk-based authentication (RBA) aims to strengthen password-based authentication rather than replacing it. RBA does this by monitoring and recording additional features during the login process. If feature values at login time differ significantly from those observed before, RBA requests an additional proof of identification. Although RBA is recommended in the NIST digital identity guidelines, it has so far been used almost exclusively by major online services. This is partly due to a lack of open knowledge and implementations that would allow any service provider to roll out RBA protection to its users.
To close this gap, we provide a first in-depth analysis of RBA characteristics in a practical deployment. We observed N=780 users with 247 unique features on a real-world online service for over 1.8 years. Based on our collected data set, we provide (i) a behavior analysis of two RBA implementations that were apparently used by major online services in the wild, (ii) a benchmark of the features to extract a subset that is most suitable for RBA use, (iii) a new feature that has not been used in RBA before, and (iv) factors which have a significant effect on RBA performance. Our results show that RBA needs to be carefully tailored to each online service, as even small configuration adjustments can greatly impact RBA's security and usability properties. We provide insights on the selection of features, their weightings, and the risk classification in order to benefit from RBA after a minimum number of login attempts.
Several species of (poly)saccharides and organic acids can be found often simultaneously in various biological matrices, e.g., fruits, plant materials, and biological fluids. The analysis of such matrices sometimes represents a challenging task. Using Aloe vera (A. vera) plant materials as an example, the performance of several spectroscopic methods (80 MHz benchtop NMR, NIR, ATR-FTIR and UV-Vis) for the simultaneous analysis of quality parameters of this plant material was compared. The determined parameters include (poly)saccharides such as aloverose, fructose and glucose as well as organic acids (malic, lactic, citric, isocitric, acetic, fumaric, benzoic and sorbic acids). 500 MHz NMR and high-performance liquid chromatography (HPLC) were used as the reference methods.
UV-VIS data can be used only for identification of added preservatives (benzoic and sorbic acids) and drying agent (maltodextrin) and semiquantitative analysis of malic acid. NIR and MIR spectroscopies combined with multivariate regression can deliver more informative overview of A. vera extracts being able to additionally quantify glucose, aloverose, citric, isocitric, malic, lactic acids and fructose. Low-field NMR measurements can be used for the quantification of aloverose, glucose, malic, lactic, acetic, and benzoic acids. The benchtop NMR method was successfully validated in terms of robustness, stability, precision, reproducibility and limit of detection (LOD) and quantification (LOQ), respectively.
All spectroscopic techniques are useful for the screening of (poly)saccharides and organic acids in plant extracts and should be applied according to its availability as well as information and confidence required for the specific analytical goal. Benchtop NMR spectroscopy seems to be the most feasible solution for quality control of A. vera products.
In January 2015, German trade and industry announced to support the national animal welfare initiative "Initiative Tierwohl" (ITW) which stands for a more sustainable and animal-friendly meat production. A web content analysis shows that the ITW initiative has been widely picked up and discussed by online media and that user comments are quite heterogeneous. The current study identifies different types of consumers through factor and cluster analysis and is based on an online survey as well as face-to-face interviews. According to our results, the identified consumer groups demonstrate a rather passive comment behaviour on the internet. In fact, the internet was hardly mentioned as an information source for meat production; consumers more frequently referred to brochures, leaflets and personal contacts with sales personnel.
The aim of this study was to investigate employees’ self-reported creativity before and after vacation and to examine the impact of recovery experiences (detachment, relaxation, mastery, meaning, autonomy, affiliation) on changes in creativity. The DRAMMA model of Newman et al. provides the theoretical background of our approach. Longitudinal data was assessed with four repeated measurements. The study encompassed data from 274 white-collar workers. Analyses showed that employees subjectively perceive their creativity to benefit not immediately after their vacation but 2 weeks later. Detachment was significantly related to lower creativity within persons, while mastery experiences explained differences in creativity between persons. This study provides a detailed picture of changes in creativity around vacations.
Although much effort is made to prevent risks arising from food, food-borne diseases are an ever present-threat to the consumers’ health. The consumption of fresh food that is contaminated with pathogens like fungi, viruses or bacteria can cause food poisoning that leads to severe health damages or even death. The outbreak of Shiga Toxin-producing enterohemorrhagic E. coli (EHEC) in Germany and neighbouring countries in 2011 has shown this dramatically. Nearly 4.000 people were reported of being affected and more than 50 people died during the so called EHEC-crisis. As a result the consumers’ trust in the safety of fruits and vegetables decreased sharply.
Although much effort is made to prevent risks arising from food, food-borne diseases are an ever-present threat to the consumers’ health. The consumption of fresh food that is contaminated with pathogens like fungi, viruses or bacteria can cause food poisoning that leads to severe health damages or even death. The outbreak of Shiga Toxin-producing enterohemorrhagic E. coli (EHEC) in Germany and neighbouring countries in 2011 has shown this dramatically. Nearly 4.000 people were reported of being affected and more than 50 people died during the so called EHEC-crisis. As a result the consumers’ trust in the safety of fruits and vegetables decreased sharply.
The transport sector is a major source of air pollution and thus a major contributor to the changing climate. As a result, in the recent past, driving bans have been imposed on cars with critical pollutant groups. As an international UN campus and self-proclaimed climate capital, the Federal City of Bonn declared a climate emergency in 2019 and participated in a federally funded “Lead City” project to optimise air quality. A key goal of the project is to reduce private motorised transport and strengthen public transport. Among the implemented measures, a “climate ticket” was introduced in 2019 whereby consumers could purchase an annual 365 € ticket for all local public transport. This paper reports on an analysis of that ticket’s changes in travel behavior.
A quantitative survey (n = 1,315) of the climate ticket users as well as the multiple regressions confirm that the climate ticket attracted more customers to the buses and trams and that a modal shift for the period of the measure was recognisable. The multiple regressions showed that the ticket was perceived significantly more positively by full-time employed users than by unemployed people. The results also show that, in addition to the price, it is essential that travel time and reliability are ensured. Furthermore, the eligible groups of people, the area of coverage, and good connecting services should be extended. To sustainably improve air quality, this type of mobility service must be optimised and introduced on a permanent basis.
The development of mobile robotic systems is a demanding task regarding its complexity, required resources and skills in multiple fields such as software development, artificial intelligence, mechanical design, electrical engineering, signal processing, sensor technology or control theory. This holds true particularly for soccer playing robots, where additional aspects like high dynamics, cooperation and high physical stress have to be dealt with. In robot competitions such as RoboCup, additional skills in the domains of team, project and knowledge management are of importance.
Background: Virtual reality combined with spherical treadmills is used across species for studying neural circuits underlying navigation.
New Method: We developed an optical flow-based method for tracking treadmil ball motion in real-time using a single high-resolution camera.
Results: Tracking accuracy and timing were determined using calibration data. Ball tracking was performed at 500 Hz and integrated with an open source game engine for virtual reality projection. The projection was updated at 120 Hz with a latency with respect to ball motion of 30 ± 8 ms.
Comparison: with Existing Method(s) Optical flow based tracking of treadmill motion is typically achieved using optical mice. The camera-based optical flow tracking system developed here is based on off-the-shelf components and offers control over the image acquisition and processing parameters. This results in flexibility with respect to tracking conditions – such as ball surface texture, lighting conditions, or ball size – as well as camera alignment and calibration.
Conclusions: A fast system for rotational ball motion tracking suitable for virtual reality animal behavior across different scales was developed and characterized.
While humans can effortlessly pick a view from multiple streams, automatically choosing the best view is a challenge. Choosing the best view from multi-camera streams poses a problem regarding which objective metrics should be considered. Existing works on view selection lack consensus about which metrics should be considered to select the best view. The literature on view selection describes diverse possible metrics. And strategies such as information-theoretic, instructional design, or aesthetics-motivated fail to incorporate all approaches. In this work, we postulate a strategy incorporating information-theoretic and instructional design-based objective metrics to select the best view from a set of views. Traditionally, information-theoretic measures have been used to find the goodness of a view, such as in 3D rendering. We adapted a similar measure known as the viewpoint entropy for real-world 2D images. Additionally, we incorporated similarity penalization to get a more accurate measure of the entropy of a view, which is one of the metrics for the best view selection. Since the choice of the best view is domain-dependent, we chose demonstration-based training scenarios as our use case. The limitation of our chosen scenarios is that they do not include collaborative training and solely feature a single trainer. To incorporate instructional design considerations, we included the trainer’s body pose, face, face when instructing, and hands visibility as metrics. To incorporate domain knowledge we included predetermined regions’ visibility as another metric. All of those metrics are taken into account to produce a parameterized view recommendation approach for demonstration-based training. An online study using recorded multi-camera video streams from a simulation environment was used to validate those metrics. Furthermore, the responses from the online study were used to optimize the view recommendation performance with a normalized discounted cumulative gain (NDCG) value of 0.912, which shows good performance with respect to matching user choices.
Risk-based authentication (RBA) is an adaptive security measure to strengthen password-based authentication against account takeover attacks. Our study on 65 participants shows that users find RBA more usable than two-factor authentication equivalents and more secure than password-only authentication. We identify pitfalls and provide guidelines for putting RBA into practice.
Neutral buoyancy has been used as an analog for microgravity from the earliest days of human spaceflight. Compared to other options on Earth, neutral buoyancy is relatively inexpensive and presents little danger to astronauts while simulating some aspects of microgravity. Neutral buoyancy removes somatosensory cues to the direction of gravity but leaves vestibular cues intact. Removal of both somatosensory and direction of gravity cues while floating in microgravity or using virtual reality to establish conflicts between them has been shown to affect the perception of distance traveled in response to visual motion (vection) and the perception of distance. Does removal of somatosensory cues alone by neutral buoyancy similarly impact these perceptions? During neutral buoyancy we found no significant difference in either perceived distance traveled nor perceived size relative to Earth-normal conditions. This contrasts with differences in linear vection reported between short- and long-duration microgravity and Earth-normal conditions. These results indicate that neutral buoyancy is not an effective analog for microgravity for these perceptual effects.
Cultivation of perennials such as Miscanthus x giganteus Greef et Deuter (Mis) combines the provision of ecosystem services and the generation of additional carbon sources for farming. The potential of Mis based fertilisers, regarding immobilisation of inorganic nitrogen (N) and build-up of soil organic matter (SOM), was tested in a field trial. Therefore, a crop rotation of winter barley (Hordeum vulgare L.), mustard (Sinapis alba L.) as catch crop, sugar beet (Beta vulgaris L.) and winter wheat (Triticum aestivum L.) was set up. The tested treatments were a mixture of Cattle Slurry (CS) and Mis, a mixture of CS and Wheat Straw (CS–WS), Cattle Manure (CM) from Mis shredded bedding, CM from WS shredded bedding, a pure CS, Urea Ammonium Nitrate (UAN) and a treatment without any N applied (NoN). When the carbon-rich fertilisers (both mixtures and manures) were applied to cereals, they led to a slight N immobilisation compared to pure CS, whereas differences were mostly not significant. Furthermore, Mis fertilisers were at least as efficient as WS-based organic fertilisers in inducing a contribution of SOM build-up and in reducing inorganic N before winter and thus preventing N losses, whereas differences were mostly not significant.
Improving the study entry supports students in a decisive phase of their university education. Implementing improvements is a change process and can only be successful if the relevant stakeholders are addressed and convinced. In the described Teaching Quality Pact project evaluation data is used as a mean to discuss in the university the situation of the study programs. As these discussions were based on empirical data rather than on opinion, it was possible to achieve an open discussion about measures that are implemented. The open discussion is maintained during the project when results of the measures taken are analyzed.
Green infrastructure has been widely recognized for the benefits to human health and biodiversity conservation. However, knowledge of the qualities and requirements of such spaces and structures for the effective delivery of the range of ecosystem services expected is still limited, as well as the identification of trade-offs between services. In this study, we apply the One Health approach in the context of green spaces to investigate how urban park characteristics affect human mental health and wildlife support outcomes and identify synergies and trade-offs between these dimensions. Here we show that perceived restorativeness of park users varies significantly across sites and is mainly affected by safety and naturalness perceptions. In turn, these perceptions are driven by objective indicators of quality, such as maintenance of facilities and vegetation structure, and subjective estimations of biodiversity levels. The presence of water bodies benefited both mental health and wildlife. However, high tree canopy coverage provided greater restoration potential whereas a certain level of habitat heterogeneity was important to support a wider range of bird species requirements. To reconcile human and wildlife needs in green spaces, cities should strategically implement a heterogeneous green infrastructure network that considers trade-offs and maximizes synergies between these dimensions.
Agricultural activities within the city boundaries have a long history in both developed and developing countries. Especially in developing countries these activities contribute to food security and the mitigation of malnutrition (food grown for home consumption). They generate additional income and contribute to recreation, environmental health as well as social interaction. In this paper, a broad approach of Urban AgriCulture is used, which includes the production of crops in urban and peri-urban areas and ranges in developed countries from allotment gardens (Schrebergarten) over community gardens (Urban Gardening) to semi-entrepreneurial self-harvest farms and fully commercialized agriculture (Urban Farming). Citizens seek to make a shift from traditional to new (sustainable) forms of food supply. From this evolves a demand for urban spaces that can be used agriculturally. The way how these citizens’ initiatives can be supported and their contribution to a resilient and sustainable urban food system increasingly attracts attention. This paper presents an empirical case study on Urban AgriCulture initiatives in the Bonn-Rhein-Sieg region (Germany). Urban AgriCulture is still a niche movement with the potential to contribute more significantly to urban development and constitute a pillar of urban quality of life.
Agricultural activities within city boundaries have a long history in both developed and developing countries. In this paper, a broad approach to Urban AgriCulture (UAC) is used, one that includes the production of crops in urban and peri-urban areas and ranges in developed countries from allotment gardens over community gardens to semi-entrepreneurial self-harvest farms and fully commercialized agriculture. With an empirical case study on UAC Initiatives in the Bonn/Rhein-Sieg region this work fills a gap since the lack of comprehensive and comparative studies on urban agriculture (UA) currently makes it difficult for researchers to identify the benefits of UA activities.
Battery lifespan estimation is essential for effective battery management systems, aiding users and manufacturers in strategic planning. However, accurately estimating battery capacity is complex, owing to diverse capacity fading phenomena tied to factors such as temperature, charge-discharge rate, and rest period duration. In this work, we present an innovative approach that integrates real-world driving behaviors into cyclic testing. Unlike conventional methods that lack rest periods and involve fixed charge-discharge rates, our approach involves 1000 unique test cycles tailored to specific objectives and applications, capturing the nuanced effects of temperature, charge-discharge rate, and rest duration on capacity fading. This yields comprehensive insights into cell-level battery degradation, unveiling growth patterns of the solid electrolyte interface (SEI) layer and lithium plating, influenced by cyclic test parameters. The results yield critical empirical relations for evaluating capacity fading under specific testing conditions.
The actomyosin system generates mechanical work with the execution of the power stroke, an ATP-driven, two-step rotational swing of the myosin-neck that occurs post ATP hydrolysis during the transition from weakly to strongly actin-bound myosin states concomitant with Pi release and prior to ADP dissociation. The activating role of actin on product release and force generation is well documented; however, the communication paths associated with weak-to-strong transitions are poorly characterized. With the aid of mutant analyses based on kinetic investigations and simulations, we identified the W-helix as an important hub coupling the structural changes of switch elements during ATP hydrolysis to temporally controlled interactions with actin that are passed to the central transducer and converter. Disturbing the W-helix/transducer pathway increased actin-activated ATP turnover and reduced motor performance as a consequence of prolonged duration of the strongly actin-attached states. Actin-triggered Pi release was accelerated, while ADP release considerably decelerated, both limiting maximum ATPase, thus transforming myosin-2 into a high-duty-ratio motor. This kinetic signature of the mutant allowed us to define the fractional occupancies of intermediate states during the ATPase cycle providing evidence that myosin populates a cleft-closure state of strong actin interaction during the weak-to-strong transition with bound hydrolysis products before accomplishing the power stroke.
Polyurethane (PU) coatings were successfully produced using unmodified kraft lignin (KL) as an environmentally benign component in contents of up to 80 wt%. Lignin samples were precipitated from industrial black liquor in aqueous solution working at room temperature and different pH levels (pH 2 to pH 5). Lignins were characterized by UV-Vis, FTIR, pyrolysis-GC/MS, SEC and 31P-NMR. Results show a correlation between pH level, OH number and molecular weight Mw of isolated lignins. Lignin-based polyurethane coatings were prepared in an efficient one step synthesis dissolving lignin in THF and PEG425 in an ultrasonic bath followed by addition of 4,4-diphenylmethanediisocyanate (MDI) and triethylamine (TEA). Crosslinking was achieved under very mild conditions (1 hour at room temperature followed by 3 hours at 35 °C). The resulting coatings were characterized regarding their physical properties including ATR-IR, TGA, optical contact angle, light microscopy, REM-EDX and AFM data. Transparent homogeneous films of high flexibility resulted from lignins isolated at pH 4, possessing a temperature resistance up to 160 °C. Swelling tests revealed a resistance against water. Swelling in DMSO depends on index, pH of precipitation and catalyst utilization for PU preparation. According to AFM studies, surface roughness is between 10 and 28 nm.
Unlimited paid time off policies are currently fashionable and widely discussed by HR professionals around the globe. While on the one hand, paid time off is considered a key benefit by employees and unlimited paid time off policies (UPTO) are seen as a major perk which may help in recruiting and retaining talented employees, on the other hand, early adopters reported that employees took less time off than previously, presumably leading to higher burnout rates. In this conceptual review, we discuss the theoretical and empirical evidence regarding the potential effects of UPTO on leave utilization, well-being and performance outcomes. We start out by defining UPTO and placing it in a historical and international perspective. Next, we discuss the key role of leave utilization in translating UPTO into concrete actions. The core of our article constitutes the description of the effects of UPTO and the two pathways through which these effects are assumed to unfold: autonomy need satisfaction and detrimental social processes. We moreover discuss the boundary conditions which facilitate or inhibit the successful utilization of UPTO on individual, team, and organizational level. In reviewing the literature from different fields and integrating existing theories, we arrive at a conceptual model and five propositions, which can guide future research on UPTO. We conclude with a discussion of the theoretical and societal implications of UPTO.
While universities are mandated to teach, research and do community outreach, studies reveal that typical university communities live in relative isolation where research is more basic than applied. This study focused on; 1) determining how WWE could be fostered through linkages between universities and external agencies (communities, public and private sectors); 2) establishing how universities’ resources could be optimized to promote research and capacity building for WWE. The dimensions of WWE studied were; 1) Technical & Business Models; 2) Capacity building; and 3) institutional frameworks. Baseline studies were conducted in which qualitative and quantitative data was collected through questionnaires, interviews, documents analysis. Experimentations were carried out whereby Laboratory tests on Bio-methane Potential (BMP) for different biomass types was conducted. A complete chain of briquettes production and consumption has been successfully piloted at St Kizito High School in Namugongo, near Kampala. The 20,000 kg of briquettes produced (from municipal bio-waste) by students monthly are used to cook in three schools whose total population is 2000 students. With an average net profit of $ 3000, the project makes business sense even in absence of social-benefit accounting. Based on start-up capital of $ 12,250, the payback period on investment is 14.7 months. Bio-char (from carbonized waste) and briquette-ash are used as organic fertilizers and biocide in vegetable gardens at the schools. New pathways for municipal waste management based on stakeholder engagement and entrepreneurship are demonstrated; departing from the conventional waste collection and disposal models. This circular enterprise which enhances Food, Agriculture, Biodiversity, Land-use and Energy (FABLE) nexus will scale-up to incorporate non-student communities (youths/women), private waste-collectors and entrepreneurs. The application of entrepreneurial models for engaging students in green enterprises integrates technological, social, economic and governance dimensions for promoting municipal sanitation, environment; energy and food security.
Multidisciplinary, multicultural, and multitasking has taken center stage in the global educational debate. Globalization and improvement in communication have affected the way organisations operate and hence influenced whom they hire. Today, it is common practice to work with people from diverse backgrounds and it requires competencies that go beyond general project management. Intercultural awareness, networking in different global communities, and learning to develop specific communication strategies for different stakeholders is all part of the package of skills and competencies that are required in today's interconnected world. This has indirect implication on the nature of skills and competencies institutions/universities must equip their students with to enable them to compete successfully in the working world.
Universities, Entrepreneurship and Enterprise Development in Africa – Conference Proceedings 2022
(2023)
These proceedings are the outcome of the 10th annual joint conference on "Universities Entrepreneurship and Enterprise Development in Africa".
These proceedings document the culmination of the 10th annual joint conference on "Universities, Entrepreneurship and Enterprise Development in Africa," which was held on the 8th and 9th of September 2022 at the Campus Sankt Augustin, Hochschule Bonn-Rhein-Sieg University of Applied Sciences. The conference was a collaboration between the University of Cape Coast, Ghana, and Hochschule Bonn-Rhein-Sieg University of Applied Sciences, Germany.
Universities, Entrepreneurship and Enterprise Development in Africa – Conference Proceedings 2020
(2021)
These proceedings are the outcome of the 8th annual joint conference on "Universities Entrepreneurship and Enterprise Development in Africa" between the University of Cape Coast, Ghana and Hochschule Bonn-Rhein-Sieg University of Applied Sciences, Germany, held on 19-20 February 2020 on Campus Sankt Augustin, Hochschule Bonn-Rhein-Sieg University of Applied Sciences.
Universities, Entrepreneurship and Enterprise Development in Africa – Conference Proceedings 2016
(2017)
These proceedings are the outcome of the 5th annual joint conference on “Universities Entrepreneurship and Enterprise Development in Africa” between the University of Nairobi, Kenya, the University of Cape Coast, Ghana, and Bonn-Rhein-Sieg University of Applied Sciences, Germany, held on 10-11 November 2016 on Campus Sankt Augustin, Bonn-Rhein-Sieg University of Applied Sciences.
Higher Education Institutions (HEIs) should, on the one hand, provide theoretical and practical knowledge to students and, on the other hand, make valuable contributions to theoretical knowledge and provide new insights by means of research. However, HEIs have to face changing and increasing demands with respect to what they are expected to achieve. Education and research issues are no longer enough, what matters today is the so called “third mission”. A specific example for implementing a third mission is the cooperation between HEIs and business incubators. With this in mind, a local consortium consisting of regional HEIs, e.g. Bonn-Rhein-Sieg University of Applied Sciences, as well as public and private institutions and partners initiated and established an incubator hub for the region Bonn/Rhein-Sieg in 2016, called “Digital Hub Region Bonn”. This conference contribution reports on our experience with regards to this cooperation approach resulting from the above- mentioned case. Furthermore the pros and cons as well as some issues of this kind of cooperation will be discussed. Last but not least this paper initiates the opportunity to share and compare the experiences of other university business incubators in Africa as well as in Germany. As we will describe, the financial investment of HEIs in a joint-incubator with other public as well as private partners offers substantial benefits, such as mutual know-how transfer from HEIs to the economy and vice versa. This strengthens entrepreneurial mindsets and activities and contributes to the development and growth of the local economy. Consequently, this cooperation sometimes creates challenges at various levels, for example due to differing interests between HEIs and business partners. This conference contribution offers approaches to solve these issues and to support private public partnership in business incubation.
Innovations in the mobility industry such as automated and connected cars could significantly reduce congestion and emissions by allowing the traffic to flow more freely and reducing the number of vehicles according to some researchers. However, the effectiveness of these sustainable product and service innovations is often limited by unexpected changes in consumption: some researchers thus hypothesize that the higher comfort and improved quality of time in driverless cars could lead to an increase in demand for driving with autonomous vehicles. So far, there is a lack of empirical evidence supporting either one or other of these hypotheses. To analyze the influence of autonomous driving on mobility behavior and to uncover user preferences, which serve as indicators for future travel mode choices, we conducted an online survey with a paired comparison of current and future travel modes with 302 participants in Germany. The results do not confirm the hypothesis that ownership will become an outdated model in the future. Instead they suggest that private cars, whether conventional or fully automated, will remain the preferred travel mode. At the same time, carsharing will benefit from full automation more than private cars. However, the findings indicate that the growth of carsharing will mainly be at the expense of public transport, showing that more emphasis should be placed in making public transport more attractive if sustainable mobility is to be developed.
Political economic analyses of recent social protection reforms in Asian, African or Latin American countries have increased throughout the last few years. Yet, most contributions focus on one social protection mechanism only and do not provide a comparative approach across policy areas. In addition, most studies are empirical studies, with no or very limited theoretical linkages. The paper aims to explain multiple trajectories of social protection reform processes looking at cash transfers and social health protection policies in Kenya. It develops a taxonomy and suggest a conceptual framework to assess and explain reform dynamics across different social protection pillars. In order to allow for a more differentiated typology and enable us to understand different reform dynamics, the article uses the approach on gradual institutional change. While existing approaches to institutional change mostly focus on institutional change prompted by exogenous shocks or environmental shifts, this approach takes account of both, exogenous and endogenous sources of change.
The development of metals tailored to the metallurgical conditions of laser-based additive manufacturing is crucial to advance the maturity of these materials for their use in structural applications. While efforts in this regard are being carried out around the globe, the use of high strength eutectic alloys have, so far, received minor attention, although previous works showed that rapid solidification techniques can result in ultrafine microstructures with excellent mechanical performance, albeit for small sample sizes. In the present work, a eutectic Ti-32.5Fe alloy has been produced by laser powder bed fusion aiming at exploiting rapid solidification and the capability to produce bulk ultrafine microstructures provided by this processing technique.
Process energy densities between 160 J/mm³ and 180 J/mm³ resulted in a dense and crack-free material with an oxygen content of ~ 0.45 wt.% in which a hierarchical microstructure is formed by µm-sized η-Ti4Fe2Ox dendrites embedded in an ultrafine eutectic β-Ti/TiFe matrix. The microstructure was studied three-dimensionally using near-field synchrotron ptychographic X-ray computed tomography with an actual spatial resolution down to 39 nm to analyse the morphology of the eutectic and dendritic structures as well as to quantify their mass density, size and distribution. Inter-lamellar spacings down to ~ 30–50 nm were achieved, revealing the potential of laser-based additive manufacturing to generate microstructures smaller than those obtained by classical rapid solidification techniques for bulk materials. The alloy was deformed at 600 °C under compressive loading up to a strain of ~ 30% without damage formation, resulting in a compressive yield stress of ~ 800 MPa.
This study provides a first demonstration of the feasibility to produce eutectic Ti-Fe alloys with ultrafine microstructures by laser powder bed fusion that are suitable for structural applications at elevated temperature.
The epithelial sodium channel (ENaC) plays a key role in salt and water homeostasis in tetrapod vertebrates. There are four ENaC subunits (α, β, γ, δ), forming heterotrimeric αβγ- or δβγ-ENaCs. While the physiology of αβγ-ENaC is well understood, for decades the field has stalled with respect to δβγ-ENaC due to the lack of mammalian model organisms. The SCNN1D gene coding for δ-ENaC was previously believed to be absent in rodents, hindering studies using standard laboratory animals. We analysed all currently available rodent genomes and discovered that SCNN1D is present in rodents but was independently lost in five rodent lineages, including the Muridae (mice and rats). The independent loss of SCNN1D in rodent lineages may be constrained by phylogeny and taxon-specific adaptation to dry habitats, however habitat aridity does not provide a selection pressure for maintenance of SCNN1D across Rodentia. A fusion of two exons coding for a structurally flexible region in the extracellular domain of δ-ENaC appeared in the Hystricognathi (a group that includes guinea pigs). This conserved pattern evolved at least 41 Ma ago and represents a new autapomorphic feature for this clade. Exon fusion does not impair functionality of guinea pig (Cavia porcellus) δβγ-ENaC expressed in Xenopus oocytes. Electrophysiological characterisation at the whole-cell and single-channel level revealed conserved biophysical features and mechanisms controlling guinea pig αβγ- and δβγ-ENaC function as compared to human orthologues. Guinea pigs therefore represent commercially available mammalian model animals that will help shed light on the physiological function of δ-ENaC.
Development of colored surfaces by formation of nano-structured aggregates is a widely used strategy in nature to color lightweight structures (e.g. butterflies) without the use of dye pigments. The deposition of nanoscale particles mimics nature in it’s approach coloring surfaces. This work presents sol-gel modification of cellulose surfaces used to form a template for growth of Cu/Cu2O core-shell particles with defined size-distributions. Besides improving the adhesion of the deposited particulate material, the sol-gel matrix serves as a template for the control of particle sizes of the Cu/Cu2O structures, and as a consequence of particle size variation the surface color is tunable. As an example, red color was achieved with an average particle size of 35 nm, and shifts gradually to blue appearance when particles have grown to 80 nm on the sol-gel modified fabric. The copper concentration on representative fabrics is kept low to avoid modifying the textile characteristics and were all in the range of 150–170 mg per g of cellulose material. As a result of copper deposition on the surface of the material, the cellulose fabric also became electrically conductive. Remarkably, the electrical conductivity was found to be dependent on the average particle sizes of the deposits and thus related to the change in observed color. The generation of color by growth of nano-sized particles on sol-gel templates provides a highly promising approach to stain surfaces by physical effects without use of synthetic colorants, which opens a new strategy to improve environmental profile of coloration.
Trust-Building in Peer-to-Peer Carsharing: Design Case Study for Algorithm-Based Reputation Systems
(2023)
Peer-to-peer sharing platforms become increasingly important in the platform economy. From an HCI-perspective, this development is of high interest, as those platforms mediate between different users. Such mediation entails dealing with various social issues, e.g., building trust between peers online without any physical presence. Peer ratings have proven to be an important mechanism in this regard. At the same time, scoring via car telematics become more common for risk assessment by car insurances. Since user ratings face crucial problems such as fake or biased ratings, we conducted a design case study to determine whether algorithm-based scoring has the potential to improve trust-building in P2P-carsharing. We started with 16 problem-centered interviews to examine how people understand algorithm-based scoring, we co-designed an app with scored profiles, and finally evaluated it with 12 participants. Our findings show that scoring systems can support trust-building in P2P-carsharing and give insights how they should be designed.
Trust your guts: fostering embodied knowledge and sustainable practices through voice interaction
(2023)
Despite various attempts to prevent food waste and motivate conscious food handling, household members find it difficult to correctly assess the edibility of food. With the rise of ambient voice assistants, we did a design case study to support households’ in situ decision-making process in collaboration with our voice agent prototype, Fischer Fritz. Therefore, we conducted 15 contextual inquiries to understand food practices at home. Furthermore, we interviewed six fish experts to inform the design of our voice agent on how to guide consumers and teach food literacy. Finally, we created a prototype and discussed with 15 consumers its impact and capability to convey embodied knowledge to the human that is engaged as sensor. Our design research goes beyond current Human-Food Interaction automation approaches by emphasizing the human-food relationship in technology design and demonstrating future complementary human-agent collaboration with the aim to increase humans’ competence to sense, think, and act.
The non-filarial and non-communicable disease podoconiosis affects around 4 million people and is characterized by severe leg lymphedema accompanied with painful intermittent acute inflammatory episodes, called acute dermatolymphangioadenitis (ADLA) attacks. Risk factors have been associated with the disease but the mechanisms of pathophysiology remain uncertain. Lymphedema can lead to skin lesions, which can serve as entry points for bacteria that may cause ADLA attacks leading to progression of the lymphedema. However, the microbiome of the skin of affected legs from podoconiosis individuals remains unclear. Thus, we analysed the skin microbiome of podoconiosis legs using next generation sequencing. We revealed a positive correlation between increasing lymphedema severity and non-commensal anaerobic bacteria, especially Anaerococcus provencensis, as well as a negative correlation with the presence of Corynebacterium, a constituent of normal skin flora. Disease symptoms were generally linked to higher microbial diversity and richness, which deviated from the normal composition of the skin. These findings show an association of distinct bacterial taxa with lymphedema stages, highlighting the important role of bacteria for the pathogenesis of podoconiosis and might enable a selection of better treatment regimens to manage ADLA attacks and disease progression.
Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC50 of 50 μM. The binding motif can influence the activity of Hsp90 by hindering ATP accessibility or the release of ADP.
It is challenging to provide users with a haptic weight sensation of virtual objects in VR since current consumer VR controllers and software-based approaches such as pseudo-haptics cannot render appropriate haptic stimuli. To overcome these limitations, we developed a haptic VR controller named Triggermuscle that adjusts its trigger resistance according to the weight of a virtual object. Therefore, users need to adapt their index finger force to grab objects of different virtual weights. Dynamic and continuous adjustment is enabled by a spring mechanism inside the casing of an HTC Vive controller. In two user studies, we explored the effect on weight perception and found large differences between participants for sensing change in trigger resistance and thus for discriminating virtual weights. The variations were easily distinguished and associated with weight by some participants while others did not notice them at all. We discuss possible limitations, confounding factors, how to overcome them in future research and the pros and cons of this novel technology.
Airborne and spaceborne platforms are the primary data sources for large-scale forest mapping, but visual interpretation for individual species determination is labor-intensive. Hence, various studies focusing on forests have investigated the benefits of multiple sensors for automated tree species classification. However, transferable deep learning approaches for large-scale applications are still lacking. This gap motivated us to create a novel dataset for tree species classification in central Europe based on multi-sensor data from aerial, Sentinel-1 and Sentinel-2 imagery. In this paper, we introduce the TreeSatAI Benchmark Archive, which contains labels of 20 European tree species (i.e., 15 tree genera) derived from forest administration data of the federal state of Lower Saxony, Germany. We propose models and guidelines for the application of the latest machine learning techniques for the task of tree species classification with multi-label data. Finally, we provide various benchmark experiments showcasing the information which can be derived from the different sensors including artificial neural networks and tree-based machine learning methods. We found that residual neural networks (ResNet) perform sufficiently well with weighted precision scores up to 79 % only by using the RGB bands of aerial imagery. This result indicates that the spatial content present within the 0.2 m resolution data is very informative for tree species classification. With the incorporation of Sentinel-1 and Sentinel-2 imagery, performance improved marginally. However, the sole use of Sentinel-2 still allows for weighted precision scores of up to 74 % using either multi-layer perceptron (MLP) or Light Gradient Boosting Machine (LightGBM) models. Since the dataset is derived from real-world reference data, it contains high class imbalances. We found that this dataset attribute negatively affects the models' performances for many of the underrepresented classes (i.e., scarce tree species). However, the class-wise precision of the best-performing late fusion model still reached values ranging from 54 % (Acer) to 88 % (Pinus). Based on our results, we conclude that deep learning techniques using aerial imagery could considerably support forestry administration in the provision of large-scale tree species maps at a very high resolution to plan for challenges driven by global environmental change. The original dataset used in this paper is shared via Zenodo (https://doi.org/10.5281/zenodo.6598390, Schulz et al., 2022). For citation of the dataset, we refer to this article.
This paper presents the preliminary results of the Socialist Republic of Vietnam country case study conducted as part of the research project Sustainable Labour Migration implemented by the University of Applied Science Bonn-Rhein-Sieg. The project focuses on stakeholder perspectives on countries of origin benefits and the sustainability of different transnational skill partnership schemes. Existing and ongoing small-scale initiatives indicate that opportunities exist for all three types of labour mobility pathways, from recruiting youth for apprenticeships and subsequent skilled work to recruitment and recognition of skilled 'professionals' certificates for direct work contracts to initial vocational education and training programs in a dual-track approach. While the latter has the highest potential to be more beneficial than other approaches, pursuing and supporting the scaling up of all three pathways in parallel will have additional, mutually reinforcing and supporting effects. The potential for benefits over and above those already realised by existing skill partnerships appears high, especially considering the favourable framework conditions specific to the long-standing German-Vietnamese relationship. If the potential of well-managed skill partnerships was realised, such sustainable models of skilled labour migration could serve as a unique selling point in the international competition for skilled labour.
In addition to the long-term goal of mitigating climate change, the current geopolitical upheavals heighten the urgency to transform Europe's energy system. This involves expanding renewable energies while managing intermittent electricity generation. Hydrogen is a promising solution to balance generation and demand, simultaneously decarbonizing complex applications. To model the energy system's transformation, the project TransHyDE-Sys, funded by the German Federal Ministry of Education and Research, takes an integrated approach beyond traditional energy system analysis, incorporating a diverse range of more detailed methods and tools. Herein, TransHyDE-Sys is situated within the recent policy discussion. It addresses the requirements for energy system modeling to gain insights into transforming the European hydrogen and energy infrastructure. It identifies knowledge gaps in the existing literature on hydrogen infrastructure-oriented energy system modeling and presents the research approach of TransHyDE-Sys. TransHyDE-Sys analyzes the development of hydrogen and energy infrastructures from “the system” and “the stakeholder” perspectives. The integrated modeling landscape captures temporal and spatial interactions among hydrogen, electricity, and natural gas infrastructure, providing comprehensive insights for systemic infrastructure planning. This allows a more accurate representation of the energy system's dynamics and aids in decision-making for achieving sustainable and efficient hydrogen network development integration.
Topics
Dialogue University President Hartmut Ihne and Jakob Rhyner, Vice Rector of the United Nations University (UNU), talk about common goals and the concept of regional internationality ...
Studies and Teaching University scores high with the Teaching Quality Pact (Pro-MINT-us), career training and Bachelor studies all in one, three attractive Master’s programmes set up, central e-Learning platform online, International Centre for Sustainable Development already hard at work ...
Research Graduate Institute establishes new Ph.D. culture, research focus on visual computing secures third-party funding, energy harvesting project wins university competition, research on the impact of zero gravity on arteries, security systems protect against car thieves ...
Campus Centre for Science and Technology Transfer, International Welcome Centre - a first stop for foreign students, alumni coordinator keeps in close contact with former students, hackathon brings students from around the world together, H-BRS prepared for the double Abitur year ...
What if ... ... the Bonn-Rhein-Sieg University of Applied Sciences did not exist? Personal answers to an unusual question ...
Region H-BRS- a strong engine for the region, research centre for region’s SMEs looks for investors, companies invest in scholarships, students advise the Alexander- Koenig-Gesellschaft, BusinessCampus opens a third location, concept for medical tourism along the Rhine corridor ...
International Mechanical engineering students in Ethiopia, businesses and universities collaborate in Ghana, university partnership with Namibia, Study Buddies for foreign students, student initiates German-Argentine Master’s degree, Spanish teacher conference, intercultural training for all university staff ...
Facts and Figures Programmes of study, statistics, organisational structure, international partnerships, awards ...
In this paper we present the steps towards a well-designed concept of a 5VR6 system for school experiments in scientific domains like physics, biology and chemistry. The steps include the analysis of system requirements in general, the analysis of school experiments and the analysis of input and output devices demands. Based on the results of these steps we show a taxonomy of school experiments and provide a comparison between several currently available devices which can be used for building such a system. We also compare the advantages and shortcomings of 5VR6 and 5AR6 systems in general to show why, in our opinion, 5VR6 systems are better suited for school-use.
Trojanized software packages used in software supply chain attacks constitute an emerging threat. Unfortunately, there is still a lack of scalable approaches that allow automated and timely detection of malicious software packages and thus most detections are based on manual labor and expertise. However, it has been observed that most attack campaigns comprise multiple packages that share the same or similar malicious code. We leverage that fact to automatically reproduce manually identified clusters of known malicious packages that have been used in real world attacks, thus, reducing the need for expert knowledge and manual inspection. Our approach, AST Clustering using MCL to mimic Expertise (ACME), yields promising results with a 𝐹1 score of 0.99. Signatures are automatically generated based on characteristic code fragments from clusters and are subsequently used to scan the whole npm registry for unreported malicious packages. We are able to identify and report six malicious packages that have been removed from npm consequentially. Therefore, our approach can support the detection by reducing manual labor and hence may be employed by maintainers of package repositories to detect possible software supply chain attacks through trojanized software packages.
The role of tourism entrepreneurship in rural development continues to be a subject of interest and debate among academia and practitioners. Theoretically, it is anticipated that tourism entrepreneurship will lead to livelihood diversification, enhancement and ultimately a revitalization of the rural economy. While tourism is posited as an accessible entrepreneurship pathway, there is a dearth of information regarding rural dwellers’ actual experiences with it, especially within the Ghanaian context. Using a case study approach and qualitative data from Wli; a rural tourism destination in Ghana, this paper delves into the opportunities and concerns associated with tourism entrepreneurship in rural areas. Data was obtained between November and December 2016 from 27 persons who were either tourism enterprise owners or employees. Findings from the study showed that entrepreneurial activities centred on the provision of accommodation, food and beverage, souvenir and guiding services. The nature of the activities enabled easy transfer of existing skills and knowledge. Further, entry into tourism entrepreneurship was perceived to be easy by the majority of study participants. These findings confirm the potential for tourism to be employed in boosting entrepreneurial activities in rural areas. Nevertheless, there were concerns regarding access to credit, institutional support, unhealthy competitions, low incomes, unguaranteed pensions, and seasonality and skewness of demand. These concerns threatened the growth and sustainability of tourism entrepreneurship within the community. From a policy perspective, there is a need for institutional recognition and support for tourism entrepreneurial intentions and activities in rural areas. Practice-wise, credit facilities need to be designed specifically for tourism-related rural enterprises. Further, periodic skills and knowledge augmentation programmes must be initiated to help expand the skill sets for the rural entrepreneurs. Finally, there is a need for the formation of traderelated networks to provide a platform for knowledge and experience sharing among the entrepreneurs.
Wireless sensor networks are widely used in a variety of fields including industrial environments. In case of a clustered network the location of cluster head affects the reliability of the network operation. Finding of the optimum location of the cluster head, therefore, is critical for the design of a network. This paper discusses the optimisation approach, based on the brute force algorithm, in the context of topology optimisation of a cluster structure centralised wireless sensor network. Two examples are given to verify the approach that demonstrate the implementation of the brute force algorithm to find an optimum location of the cluster head.
While 14 % of the world's working-age population currently lives in sub-Saharan Africa (SSA), this figure will predictably be higher than the rest of the world combined by 2036. If this demographic group finds meaningful employment, Africa experiences an economic and social upswing. To tap this potential, the paper intends to answer the research question, "What are the prerequisites and how are they defined for the successful implementation of sustainable business model ideas in SSA?", by developing a top ten ranking consisting of previously identified sustainable business model ideas best suited for productive use. This achieves a novel approach to implementing future-oriented business models and contributes to current research on sustainable models. Since the geographical scope of SSA is pervasive, this paper focuses on Namibia, Rwanda, Senegal, and Uganda. An extensive literature review on these countries was conducted to gain a broader understanding of the situation in SSA. Additionally, research was carried out on the agricultural, energy, and information and communications technology (ICT) sectors to identify the most promising ideas. To contribute to current knowledge, experts were interviewed, and panel discussions were analyzed. Furthermore, the Business Model Canvas (BMC) was combined with the circular economy concept, which served as a framework for the business model ideas. Experts evaluated these ideas, which were subsequently ranked using fuzzy logic with artificial intelligence, based on the system for exploring country risks (CRISK-Explorer). The paper shows that skipping individual development processes opens up promising opportunities, such as the ICT-based business model e-crowd logistics or the renewable energy-based model e-Boda-Boda. Seven prerequisites for the successful implementation of these ideas were identified and defined: value delivery, promising customers, sufficient capital, presence of key resources, possibility to perform the key activities, sustainability, and profitability. The paper concludes by identifying limitations and suggesting avenues for future research.
With increasing life expectancy, demands for dental tissue and whole-tooth regeneration are becoming more significant. Despite great progress in medicine, including regenerative therapies, the complex structure of dental tissues introduces several challenges to the field of regenerative dentistry. Interdisciplinary efforts from cellular biologists, material scientists, and clinical odontologists are being made to establish strategies and find the solutions for dental tissue regeneration and/or whole-tooth regeneration. In recent years, many significant discoveries were done regarding signaling pathways and factors shaping calcified tissue genesis, including those of tooth. Novel biocompatible scaffolds and polymer-based drug release systems are under development and may soon result in clinically applicable biomaterials with the potential to modulate signaling cascades involved in dental tissue genesis and regeneration. Approaches for whole-tooth regeneration utilizing adult stem cells, induced pluripotent stem cells, or tooth germ cells transplantation are emerging as promising alternatives to overcome existing in vitro tissue generation hurdles. In this interdisciplinary review, most recent advances in cellular signaling guiding dental tissue genesis, novel functionalized scaffolds and drug release material, various odontogenic cell sources, and methods for tooth regeneration are discussed thus providing a multi-faceted, up-to-date, and illustrative overview on the tooth regeneration matter, alongside hints for future directions in the challenging field of regenerative dentistry.
Work-related thoughts during off-job time have been studied extensively in occupational health psychology and related fields. We provide a focused review of the research on overcommitment—a component within the effort–reward imbalance model—and aim to connect this line of research to the most commonly studied aspects of work-related rumination. Drawing on this integrative review, we analyze survey data on ten facets of work-related rumination, namely (1) overcommitment, (2) psychological detachment, (3) affective rumination, (4) problem-solving pondering, (5) positive work reflection, (6) negative work reflection, (7) distraction, (8) cognitive irritation, (9) emotional irritation, and (10) inability to recover. First, we apply exploratory factor analysis to self-reported survey data from 357 employees to calibrate overcommitment items and to position overcommitment within the nomological net of work-related rumination constructs. Second, we leverage apply confirmatory factor analysis to self-reported survey data from 388 employees to provide a more specific test of uniqueness vs. overlap among these constructs. Third, we apply relative weight analysis to assess the unique criterion-related validity of each work-related rumination facet regarding (1) physical fatigue, (2) cognitive fatigue, (3) emotional fatigue, (4) burnout, (5) psychosomatic complaints, and (6) satisfaction with life. Our results suggest that several measures of work-related rumination (e.g., overcommitment and cognitive irritation) can be used interchangeably. Emotional irritation and affective rumination emerge as the strongest unique predictors of fatigue, burnout, psychosomatic complaints, and satisfaction with life. Our study is intended to assist researchers in making informed decisions on selecting scales for their research and paves the way for integrating research on the effort–reward imbalance and work-related rumination.
Tourism in Rwanda is challenging. Since the country is small and hilly, it is difficult to tap the potential. As the country is blessed with diverse nature, the Rwandan government decided to combine ecotourism with high-end tourism, to exploit the full potential. This study aims to assess the extent to which these two types of tourism fit together, as well as if sustainability is a decisive argument in this upscale segment. In this context, ecotourism is characterized by its 3 core criteria: education, nature and sustainability. To evaluate the main question: to what extent can ecotourism projects help to promote the perception of Rwanda as a high-end tourist destination on the German market? As well as if sustainability is a decisive argument, interviews with stakeholder from the Rwandan tourism industry as well as German tour operators were conducted, to gain an understanding of both sites and then evaluate them according to the 3 ecotourism core criteria and the demands of high-end tourists. The results showed that there is a difference in the perception of the needs of high-end tourists. While the 3 core criteria seem to be too relevant while they are in booking decision with the tour operator. The high-end lodges in Rwanda state an interest in these three criteria. It is evident from the results that there is a limited active demand for sustainable tourist products, while nature and education are more relevant, but not yet fully exploited. However, all interviewees indicated that ecotourism, and in particular sustainability, is experiencing an increase in demand and will continue to grow in importance in the future. Accordingly, the results suggest the driving markets approach is relevant to further drive demand in that segment.
The central theme of the 2014 Annual Report is human thinking.
In an interview, University President Hartmut Ihne and 3Sat moderator Gert Scobel discuss the concept of thought: "Should we be allowed to give up our autonomy voluntarily?"
Our university’s Language Centre Director James Chamberlain examines to what extent thinking varies in different languages.
Professor Paul Plöger from the Department of Computer Science explains why robots have tremendous problems understanding complex relationships in open environments.
Rather than focusing solely on our university’s future, the Annual Report links the fascinating theme to the enormous variety of life, research and tuition offered by H-BRS.
Therapeutic Treatments for Osteoporosis-Which Combination of Pills Is the Best among the Bad?
(2022)
Osteoporosis is a chronical, systemic skeletal disorder characterized by an increase in bone resorption, which leads to reduced bone density. The reduction in bone mineral density and therefore low bone mass results in an increased risk of fractures. Osteoporosis is caused by an imbalance in the normally strictly regulated bone homeostasis. This imbalance is caused by overactive bone-resorbing osteoclasts, while bone-synthesizing osteoblasts do not compensate for this. In this review, the mechanism is presented, underlined by in vitro and animal models to investigate this imbalance as well as the current status of clinical trials. Furthermore, new therapeutic strategies for osteoporosis are presented, such as anabolic treatments and catabolic treatments and treatments using biomaterials and biomolecules. Another focus is on new combination therapies with multiple drugs which are currently considered more beneficial for the treatment of osteoporosis than monotherapies. Taken together, this review starts with an overview and ends with the newest approaches for osteoporosis therapies and a future perspective not presented so far.
Studies in entrepreneurship education in hospitality and tourism has indicated that further attention could be given toward helping students to develop creativity and critical thinking skills, engage in deeper self-discovery experiences, and understand tourism more fully to help prepare them for entrepreneurial roles. This study aims at evaluating Hospitality entrepreneurial modules offered in Tourism programs in Ghanaian institutions. The curriculum of Tourism in two tertiary institutions in Ghana offering Tourism is studied. The research highlights on the need to integrate hospitality technical skills into Tourism education to create a culture that will enhance the growth of entrepreneurial hospitality into Tourism as culinary Tourism is becoming common. Some of the challenges faced by tourism students and entrepreneurship educators are highlighted. Structured interview technique was used to collect data from 20 purposive sampled students of the selected institutions. The results revealed that the level of importance and attention given to hospitality skills in tourism and the perception of students on acquisition of the required competencies is minimal. It is therefore recommended that more skills and competences in hospitality operation, food and beverage production and service be introduced in tourism education in a more holistic manner with emphasis on skill acquisition in order to make the tourism graduate more creative and critical thinker in today’s global competitive environment.
Although p27 plays a central role in cell cycle regulation, its role in breast cancer prognosis is controversial. Furthermore, the p27 gene CDKN1B carries a polymorphism with unknown functional relevance. This study was designed to evaluate p27 expression and p27 genotyping with respect to early breast cancer prognosis. 279 patients with infiltrating metastasis-free breast cancer were included in this study. p27 expression was determined in tumor tissue specimens from 261 patients by immunohistochemistry. From 108 patients, the CDKN1B genotype was examined by PCR and subsequent direct sequencing. 55.2% of the tumors were considered p27 positive. p27 expression did not correlate with any of the established parameters except for nodal involvement but significantly correlated to prolonged disease-free survival. In 35% of the tumors analyzed, the CDKN1B gene showed a polymorphism at codon 109 (V109G). The V109G polymorphism correlated with greater nodal involvement. In the node-negative subgroup, V109G correlated significantly with a shortened disease-free survival. In conclusion, the determination of the CDKN1B genotype might be a powerful tool for the prognosis of patients with early breast cancer.
We present the performance of the upGREAT heterodyne array receivers on the SOFIA telescope after several years of operations. This instrument is a multi-pixel high resolution (R≳107) spectrometer for the Stratospheric Observatory for Far-Infrared Astronomy (SOFIA). The receivers use 7-pixel subarrays configured in a hexagonal layout around a central pixel. The low frequency array receiver (LFA) has 2×7 pixels (dual polarization), and presently covers the 1.83–2.07THz frequency range, which allows to observe the [CII] and [OI] lines at 158μm and 145μm wavelengths. The high frequency array (HFA) covers the [OI] line at 63μm and is equipped with one polarization at the moment (7 pixels, which can be upgraded in the near future with a second polarization array). The 4.7THz array has successfully flown using two separate quantum-cascade laser local oscillators from two different groups. NASA completed the development, integration and testing of a dual-channel closed-cycle cryocooler system, with two independently operable He compressors, aboard SOFIA in early 2017 and since then, both arrays can be operated in parallel using a frequency separating dichroic mirror. This configuration is now the prime GREAT configuration and has been added to SOFIA’s instrument suite since observing cycle 6.
The universal basic income grant (UBIG): A comparative review of the characteristics and impact
(2021)
In recent years, public debates, pilot projects and academic research have internationally boosted the prominence of the universal basic income grant (UBIG) as a policy option. Despite this prominence, the arguments and evidence of the UBIG discussion have not been systematically put forward and discussed in light of the different UBIG conceptual understandings and applications. This paper adds value to the debate by systematic presenting the social, economical and political arguments in support of and against a UBIG. It furthermore discusses the UBIG dimensions/characteristics and variations, and also pose questions about whether all the UBIG experiments can really be classified as a UBIG. Antagonist of a UBIG often raise concerns about the negative effect of the lack of conditions and targeting in a UBIG. Since evidence on the impact of UBIG is limited, this paper turns to the evidence base on unconditional cash transfers and conditional cash transfers. The results show that it is the cash transfer rather than the conditionality and targeting that produce positive outcomes in areas of personal wellbeing.
In 2018, in the US alone, it is estimated that 268,670 people will be diagnosed with breast cancer, and that 41,400 will die from it. Since breast cancers often become resistant to therapies, and certain breast cancers lack therapeutic targets, new approaches are urgently required. A cell-stress response pathway, the unfolded protein response (UPR), has emerged as a promising target for the development of novel breast cancer treatments. This pathway is activated in response to a disturbance in endoplasmic reticulum (ER) homeostasis but has diverse physiological and disease-specific functions. In breast cancer, UPR signalling promotes a malignant phenotype and can confer tumours with resistance to widely used therapies. Here, we review several roles for UPR signalling in breast cancer, highlighting UPR-mediated therapy resistance and the potential for targeting the UPR alone or in combination with existing therapies.
Through the “Act to Strengthen the Non-financial Reporting by Corporations in their Management and Group Management Reports” (Gesetz zur Stärkung der nichtfinanziellen Berichterstattung der Unternehmen in ihren Lage- und Konzernlageberichten) (CSR Directive Transposition Act, „CSR-RUG“) of 11 April 2017[1], the German Bundestag implemented Directive 2014/95/EU (“CSR Directive”)[2] into German law. Following the European impetus, the CSR-RUG enriches the traditional repertoire of forms of action under environmental law by a further instrument. Already the regulatory context gives an idea of its atypical nature: The centrepiece of the CSR-RUG is the amendment of and addition to the Third Book of the German Commercial Code (Handelsgesetzbuch, “HGB”), which deals with the “trading books” of undertakings, i.e., accounting and reporting requirements. Since the reporting year 2017, large capital market-oriented corporations must report extensively within the framework of their annual management reports on their activities and effects in certain areas of “Corporate Social Responsibility”. This also includes environmental matters. The transparency and publicity this entails is intended to generate positive stimuli for more responsible, sustained and not least of all environmentally friendly entrepreneurial action.
Following a brief presentation of the European legal bases and their implementation in Germany (I.), we will classify the provisions within the underlying concept of Corporate Social Responsibility (II.) and analyse and systemise the governance effects of non-financial reporting (III.). A few remarks on selected aspects of the chosen approach and its implementation (IV.) as well as an outlook summarising our conclusions (V.) will complete this article. By detailing the German approach to transposing the CSR Directive, this paper intends to provide an example of the challenges member state legislators face when complying with modern governance concepts such as Corporate Social Responsibility by way of non-financial reporting obligations.
[1] Federal Law Gazette, Part I 2017, 802 et seq.
[2] Directive 2014/95/EU of the European Parliament and of the Council 22 October 2014 amending Directive 2013/34/EU as regards disclosure of non-financial and diversity information by certain large undertakings and groups, OJ EU No. L 330, p. 1.
Maintaining orientation in an environment with non-Earth gravity (1 g) is critical for an astronaut's operational performance. Such environments present a number of complexities for balance and motion. For example, when an astronaut tilts due to ascending or descending an inclined plane on the moon, the gravity vector will be tilted correctly, but the magnitude will be different from on earth. If this results in a mis-perceived tilt, then that may lead to postural and perceptual errors, such as mis-perceiving the orientation of oneself or the ground plane and corresponding errors in task judgment.
Farming communities confronted with climate change adopt formal and informal adaptation strategies to mitigate the effects of climate change. While the environmental and social effects of climate change are well documented, there is still a dearth of literature on girl-child marriage (formal marriage or informal union between a child under the age of 18 and an adult or another child) as a response to the effects of climate change. In this research, we ask if girl-child marriage is promoted as a social protection mechanism first, rather than as simply a response to climate-induced poverty. We use qualitative semi-structured interviews and focus group discussions to explore this question in a rural farming community in Northern Ghana. Our findings reveal that climate change shocks result in poverty and compel farmers to marry off their young daughters. The unmarried girl-child is perceived as an ‘extra mouth to feed’, a liability whose marriage becomes a strategy for protecting the family, the family’s reputation, and the girl child. The emphasis in girl-child marriage is not on the girl-child as an individual but on the family as a group. Hence, what is good for the family is assumed to be in the best interest of the girl-child. We place our analysis at the intersection of climate change, social protection, and the incidence of girl-child marriages. We argue that understanding this link is crucial and can contribute significantly to our knowledge of girl-child marriage as well as our ability to address this in Sub-Saharan Africa.
Namibia’s hunting industry is increasingly threatened by animal rightists and opponent groups whose adversarial mindset is mostly based on emotion orientated information. The fatal consequences if closing hunting tourism in a country like Namibia are expounded in this study by critically investigating the input of well-regulated hunting tourism towards conservation in Namibia. Different factors have to be taken into consideration, regarding the country’s attributes that differ significantly from other countries and their methods to achieve successful conservation management strategies. By conducting an in-depth interview with Mr. Volker Grellmann and by obtaining secondary data from local authorities and organizations, the current research investigates how well-regulated hunting tourism in Namibia is an important part of biodiversity conservation. The results outline that hunting tourism is crucial for the value of wildlife and yields for wildlife to have a greater benefit than livestock and crop farming in Namibia. Likewise, the country takes care of their valuable natural recourse. As a result, natural habitats are induced, and subsequently a steeply growing number of wildlife was recorded over the last 50 years in Namibia. Among others hunting tourism favors the development of rural areas and yields incentives to fight poaching and the illegal trade of wild animal products.
Rural Social Entrepreneurship (RSE) is considered an essential factor for achieving Sustainable Rural Development (SRD) and improving rural people's socio-economic status through increasing production, productivity, reducing unemployment, and accelerating the progress in achieving SDGs. The paper aims at examining the role of social entrepreneurship in achieving (SRD) in Sudan with reference to Wad Balal Project for investment and rural development in Gezira State, which established in 2005 in small villages in Gezira State through mobilizing of local savings and resources for creating job opportunities, sponsoring poor households, improving the infrastructures, and reducing poverty. The study depends on cross-sectional data collected through a questionnaire and focus group discussion from 100 head of households in the village under research. A questionnaire is internally consistent, and its questions are stable. Frequencies and percentages have been used for describing the basic characteristics of the respondents. Statistical t-test was adopted to test the opinions of respondents about the role of the project based on the Likert scale. The results revealed that the project has significantly increased the opportunities of job and training as well as household income, the results also confirmed that the project has improved the status of education and health services in the village. The project has extended and established many branches; the project also diversified its investment to cover more kinds of investments, the project reinvested 50% of its profits and directed the rest to charity, and social services in the village, many lessons can be learned from the project story. The research recommended that a similar social entrepreneurship project can be generalized to more villages in Sudan and other developing countries to accelerate sustainable rural development. Local communities have to support similar initiatives for developing their villages.
A major challenge modern society has to face is the increasing need for tissue regeneration due to degenerative diseases or tumors, but also accidents or warlike conflicts. There is great hope that stem cell-based therapies might improve current treatments of cardiovascular diseases, osteochondral defects or nerve injury due to the unique properties of stem cells such as their self-renewal and differentiation potential. Since embryonic stem cells raise severe ethical concerns and are prone to teratoma formation, adult stem cells are still in the focus of research. Emphasis is placed on cellular signaling within these cells and in between them for a better understanding of the complex processes regulating stem cell fate. One of the oldest signaling systems is based on nucleotides as ligands for purinergic receptors playing an important role in a huge variety of cellular processes such as proliferation, migration and differentiation. Besides their natural ligands, several artificial agonists and antagonists have been identified for P1 and P2 receptors and are already used as drugs. This review outlines purinergic receptor expression and signaling in stem cells metabolism. We will briefly describe current findings in embryonic and induced pluripotent stem cells as well as in cancer-, hematopoietic-, and neural crest-derived stem cells. The major focus will be placed on recent findings of purinergic signaling in mesenchymal stem cells addressed in in vitro and in vivo studies, since stem cell fate might be manipulated by this system guiding differentiation towards the desired lineage in the future.
Over the past two decades many governments of low and middle income countries have started to introduce social protection measures or to extend the coverage and improve the functioning of public social protection systems. These reforms are a "global phenomenon" and can be observed in many African, Asian and Latin American countries. This paper focuses on international determinants for policy change within social protection by assessing the state of the art of both policy diffusion and policy transfer studies. Empirical studies of policy transfer and diffusion in the field of social protection are furthermore assessed in light of the theoretical background.
In recent years, there has been a growing interest in the start-up scene in sub-Saharan Africa. "Silicon Savannah" is today widely used to describe the thriving IT industry in and around Nairobi. Kenya's geographical advantage, its favorable economic reforms, and mature start-up ecosystem makes it stands out positively. Since a lot of hype exists around the start-up scene many investors are drawn to it, but in reality very few start-ups are investment-ready. The increasing start-up requirements and needs force incubators to diversify their offer. In contrast, to traditional incubators, an Innovation Hub (Hub) is characterized based on the concept of open innovation and collaboration. A Hub nurtures an enabling environment where a community of entrepreneurs can grow. At the same time, it serves as a nexus point for the local start-up community, investors, academia, technology companies and the wider private sector. It aims to create a structure where people serendipitously interact with others that they would not typically meet. Considering the great interest for and the large amounts of money invested in Hubs by governments, universities, private companies and other interested parties, not only researchers have been raising the question of the actual benefit of Hubs. This research study aims to investigate to what extent the support offered by the Hubs is tackling the challenges faced by start-ups in Nairobi, Kenya. The analysis can serve as a basis for identifying strength and weaknesses in the Hub models.
Over the years, entrepreneurship has proven to be one of the key roles towards development. The cycle of business start-ups and growth are linked to the socio-economic benefits of the global world at large. With a growing world population of over 7billion people, the existence of universities (both public &private) as well as enterprises has increased globally in the 21st century. The mission and purpose behind Universities, Entrepreneurship and Enterprises thrive on development in the areas of capacity building, skill acquisition, training and knowledge amongst others. Africa alone has a population of over 1.2billion people with about 650 recognized universities and over 140,000 registered businesses (enterprises) in Ghana alone. A case study in Ghana reveals three key drivers towards entrepreneurship and the role university education has played in various business establishments. The drivers are problem statements, resources and research findings. Some of these notions to business include the management of risk, research findings and customer relationship. These are major features that need critical attention and play a role in business and entrepreneurship in Africa. A major success in business and entrepreneurship is the utilization of the human resource population and the lifeline support given to households in terms of income, while a barrier being the limited access to credit support from the financial companies at the inception stages. In conclusion, this conference should develop a practical book guide on business start-ups and entrepreneurship knowledge to be used at the various universities in Africa to enhance development.
One of the primary current astrobiological goals is to understand the limits of microbial resistance to extraterrestrial conditions. Much attention is paid to ionizing radiation, since it can prevent the preservation and spread of life outside the Earth. The aim of this research was to study the impact of accelerated He ions (150 MeV/n, up to 1 kGy) as a component of the galactic cosmic rays on the black fungus C. antarcticus when mixed with Antarctic sandstones—the substratum of its natural habitat—and two Martian regolith simulants, which mimics two different evolutionary stages of Mars. The high dose of 1 kGy was used to assess the effect of dose accumulation in dormant cells within minerals, under long-term irradiation estimated on a geological time scale. The data obtained suggests that viable Earth-like microorganisms can be preserved in the dormant state in the near-surface scenario for approximately 322,000 and 110,000 Earth years within Martian regolith that mimic early and present Mars environmental conditions, respectively. In addition, the results of the study indicate the possibility of maintaining traces within regolith, as demonstrated by the identification of melanin pigments through UltraViolet-visible (UV-vis) spectrophotometric approach.
Background: Staurosporine-dependent single and collective cell migration patterns of breast carcinoma cells MDA-MB-231, MCF-7, and SK-BR-3 were analysed to characterise the presence of drug-dependent migration promoting and inhibiting yin-yang effects. Methods: Migration patterns of various breast cancer cells after staurosporine treatment were investigated using Western blot, cell toxicity assays, single and collective cell migration assays, and video time-lapse. Statistical analyses were performed with Kruskal–Wallis and Fligner–Killeen tests. Results: Application of staurosporine induced the migration of single MCF-7 cells but inhibited collective cell migration. With the exception of low-density SK-BR-3 cells, staurosporine induced the generation of immobile flattened giant cells. Video time-lapse analysis revealed that within the borderline of cell collectives, staurosporine reduced the velocity of individual MDA-MB-231 and SK-BR-3, but not of MCF-7 cells. In individual MCF-7 cells, mainly the directionality of migration became disturbed, which led to an increased migration rate parallel to the borderline, and hereby to an inhibition of the migration of the cell collective as a total. Moreover, the application of staurosporine led to a transient activation of ERK1/2 in all cell lines. Conclusion: Dependent on the context (single versus collective cells), a drug may induce opposite effects in the same cell line.
The Poverty Reduction Effect of Social Protection: The Pros and Cons of a Multidisciplinary Approach
(2022)
There is a growing body of knowledge on the complex effects of social protection on poverty in Africa. This article explores the pros and cons of a multidisciplinary approach to studying social protection policies. Our research aimed at studying the interaction between cash transfers and social health protection policies in terms of their impact on inclusive growth in Ghana and Kenya. Also, it explored the policy reform context over time to unravel programme dynamics and outcomes. The analysis combined econometric and qualitative impact assessments with national- and local-level political economic analyses. In particular, dynamic effects and improved understanding of processes are well captured by this approach, thus, pushing the understanding of implementation challenges over and beyond a ‘technological fix,’ as has been argued before by Niño-Zarazúa et al. (World Dev 40:163–176, 2012), However, multidisciplinary research puts considerable demands on data and data handling. Finally, some poverty reduction effects play out over a longer time, requiring longitudinal consistent data that is still scarce.
The article contributes to understanding the political economy of implementation of social protection programmes at local level. Current debates are dominated by technocratic arguments, emphasizing the lack of financial resources, technology or skills as major barriers for effective implementation. Describing how chiefs, assistant-chiefs and community elders are routinely at the centre stage of core implementation processes, including targeting, enrolment, delivery, monitoring, awareness and information, data collection or grievance and redress, this study on Kenya argues for the need to look more closely into the local political economy as an important mediating arena for implementing social policies. Implementation is heavily contingent upon the local social, political and institutional context that influences and shapes its outcomes. These processes are ambivalent involving multiple forms of interactions between ‘formal’ and ‘informal’ institutional structures, which may support initial policy objectives or induce policy outcomes substantially diverging from intended policy objectives.
The paper contributes to the debate on the political economy of implementation of propoor social policy. It argues for a broadening of the debate, which is dominated by technocratic arguments, emphasizing the lack of financial resources, technology or skills as the major barriers for effective implementation. Describing the dynamic interplay of ‘formal’ operational programme structures and ‘informal’ traditional institutions in delivering the CT-OVC – the largest and oldest cash transfer programme in Kenya – it argues for the need to look more closely into the local political economy as an important mediating arena for implementing social policies. Implementation is heavily contingent upon the local social, political and institutional context that influences and shapes its outcomes. These processes are highly dynamic and ambivalent evolving between ‘formal’ and ‘informal’ structures and institutions. They may change over time and place, challenging the implicit assumption that programmes are evenly implemented across geographic and political entities.
In the last two decades, studies that analyse the political economy of sustainable energy transitions have increasingly become available. Yet very few attempts have been made to synthesize the factors discussed in the growing literature. This paper reviews the extant empirical literature on the political economy of sustainable energy transitions. Using a well-defined search strategy, a total of 36 empirical contributions covering the period 2008 to 2022 are reviewed full text. Overall, the findings highlight the role of vested interest, advocacy coalitions and green constituencies, path dependency, external shocks, policy and institutional environment, political institutions and fossil fuel resource endowments as major political economy factors influencing sustainable energy transitions across both high income countries, and low and middle income countries. In addition, the paper highlights and discusses some critical knowledge gaps in the existing literature and provides suggestions for a future research agenda.
In an effort to assist researchers in choosing basis sets for quantum mechanical modeling of molecules (i.e. balancing calculation cost versus desired accuracy), we present a systematic study on the accuracy of computed conformational relative energies and their geometries in comparison to MP2/CBS and MP2/AV5Z data, respectively. In order to do so, we introduce a new nomenclature to unambiguously indicate how a CBS extrapolation was computed. Nineteen minima and transition states of buta-1,3-diene, propan-2-ol and the water dimer were optimized using forty-five different basis sets. Specifically, this includes one Pople (i.e. 6-31G(d)), eight Dunning (i.e. VXZ and AVXZ, X=2-5), twenty-five Jensen (i.e. pc-n, pcseg-n, aug-pcseg-n, pcSseg-n and aug-pcSseg-n, n=0-4) and nine Karlsruhe (e.g. def2-SV(P), def2-QZVPPD) basis sets. The molecules were chosen to represent both common and electronically diverse molecular systems. In comparison to MP2/CBS relative energies computed using the largest Jensen basis sets (i.e. n=2,3,4), the use of smaller sizes (n=0,1,2 and n=1,2,3) provides results that are within 0.11--0.24 and 0.09-0.16 kcal/mol. To practically guide researchers in their basis set choice, an equation is introduced that ranks basis sets based on a user-defined balance between their accuracy and calculation cost. Furthermore, we explain why the aug-pcseg-2, def2-TZVPPD and def2-TZVP basis sets are very suitable choices to balance speed and accuracy.
Companies often have difficulties determining which criteria to base their investment decisions in different countries on. When considering direct foreign investment several risk indices are available. The PCI (Peren-Clement-Index) in its original form was developed in 1998. Its further refinement improves the PCI in three major ways: First, it offers a dynamic adjustment of criteria and consideration of recent changes in the international environment. Second, it provides business specificities of a company or its industrial sector to be considered in addition to macroeconomic aspects by a two-dimensional presentation, which ensures a customized assessment. Third, the PCI allows for consolidating investment decisions by combining a resource-orientated with a market-oriented view. The PCI allows, unlike other indices, a customized and company-specific strategic planning process. Ultimately companies must take up both perspectives in the context of an international investment decision. The use of risk indices in corporate planning for assessing global investments decision creates a fundamentally new of risk assessment.
Mesenchymal stem cells (MSCs) are an attractive cell source for Regenerative Dentistry in particular due to their ability to differentiate towards osteoblasts, among other lineages. Tooth and jaw bone loss are frequent sequelae of traumatic and pathological conditions in both the young and the elderly and must be met by appropriate prosthetic replacements. For successful osseointegration of the dental implant a sufficient bone level is necessary. Besides the utilization of bone autografts or synthetic biomaterials, medical research is more and more focused on the utilization of MSCs. Compared to cells obtained from liposuction material, ectomesenchymal stem cells derived from the head area e.g. out of dental follicles or particulate, non-vascularized bone chips show a higher differentiation potential towards osteoblasts.
New communication technologies are changing the way we work and communicate with people around the world. Given this reality, students in Higher Education (HE) worldwide need to develop knowledge in their area of study as well as attitudes and values that will enable them to be responsible and ethical global citizens in the workforce they will soon enter, regardless of the degree. Different institutional and country-specific requirements are important factors when developing an international Virtual Exchange (VE) program. Digital learning environments such as ProGlobe – Promoting the Global Exchange of Ideas on Sustainable Goals, Practices, and Cultural Diversity – offer a platform for collaborating with diverse students around the world to share and reflect on ideas on sustainable practices. Students work together virtually on a joint interdisciplinary project that aims to create knowledge and foster cultural diversity. This project was successfully integrated into each country’s course syllabus through a common global theme; sustainability. The focus of this paper is to present multi-disciplinary perspectives on the opportunities and challenges in implementing a VE project in HE. Furthermore, it will present the challenges that country coordinators dealt with when planning and implementing their project. Given the disparity found in each course syllabus, project coordinators uniquely handled the project goal, approach, and assessment for their specific course and program. Not only did the students and faculty gain valuable insight into different aspects of collaboration when working in interdisciplinary HE projects, they also reflected on their own impact on the environment and learned to listen to how people in different countries deal with environmental issues. This approach provided students with meaningful intercultural experiences that helped them link ideas and concepts about a global issue through the lens of their own discipline as well as other disciplines worldwide.
The ability to discriminate between different ionic species, termed ion selectivity, is a key feature of ion channels and forms the basis for their physiological function. Members of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily of trimeric ion channels are typically sodium selective, but to a surprisingly variable degree. While acid-sensing ion channels (ASICs) are weakly sodium selective (sodium:potassium ratio ∼10:1), ENaCs show a remarkably high preference for sodium over potassium (>500:1). This discrepancy may be expected to originate from differences in the pore-lining second transmembrane segment (M2). However, these show a relatively high degree of sequence conservation between ASICs and ENaCs, and previous functional and structural studies could not unequivocally establish that differences in M2 alone can account for the disparate degrees of ion selectivity. By contrast, surprisingly little is known about the contributions of the first transmembrane segment (M1) and the preceding pre-M1 region. In this study, we used conventional and noncanonical amino acid-based mutagenesis in combination with a variety of electrophysiological approaches to show that the pre-M1 and M1 regions of mASIC1a channels are major determinants of ion selectivity. Mutational investigations of the corresponding regions in hENaC show that these regions contribute less to ion selectivity, despite affecting ion conductance. In conclusion, our work suggests that the remarkably different degrees of sodium selectivity in ASICs and ENaCs are achieved through different mechanisms. These results further highlight how M1 and pre-M1 are likely to differentially affect pore structure in these related channels.
The Learning Culture Survey (LCS) is a questionnaire-based research, investigating students’ perceptions of and expectations towards Higher Education (HE). The aim of this survey is to improve our understanding about the sources of cultural conflicts in educational scenarios. This understanding, shell help us to predict potential conflict situations and develop supportive measures.
After three years of development, the LCS was initialized in 2010 in South Korea and Germany. During the following years, the investigations were extended to further countries. The results, on the one hand, provided insights about the cultural context of HE in general and on the other hand, about specific (national / regional) characteristics of learners in HE. Most issues targeted with the questionnaire were directly linked to value systems. Thus, we expected from the beginning that the collected data would keep valid over longer periods of time. However, we had no evidence regarding the actual persistence of learning culture. For a study, designed to being implemented on a global scope and providing input for further applications, persistence is a basic condition to justify related investigations.
To answer the question on persistence, we repeated the LCS in our university every four years, between 2010 to 2018/19. Besides a small number of slight changes, explainable out of their situational context, the overall results kept consistent over the investigated years. In this paper, after an introduction of the LCS’ concept, setting and its general results from the past years, we present the insights from our most recently finalized longitudinal study on learning culture.
Exposure to microgravity conditions causes cardiovascular deconditioning in astronauts during spaceflight. Until now, no specific drugs are available for countermeasure, since the underlying mechanism is largely unknown. Endothelial cells (ECs) and smooth muscle cells (SMCs) play key roles in various vascular functions, many of which are regulated by purinergic 2 (P2) receptors. However, their function in ECs and SMCs under microgravity conditions is still unclear. In this study, primary ECs and SMCs were isolated from bovine aorta and verified with specific markers. We show for the first time that the P2 receptor expression pattern is altered in ECs and SMCs after 24 h exposure to simulated microgravity using a clinostat. However, conditioned medium compensates this change in specific P2 receptors, for example, P2X7. Notably, P2 receptors such as P2X7 might be the important players during the paracrine interaction. Additionally, ECs and SMCs secreted different cytokines under simulated microgravity, leading into a pathogenic proliferation and migration. In conclusion, our data indicate P2 receptors might be important players responding to gravity changes in ECs and SMCs. Since some artificial P2 receptor ligands are applied as drugs, it is reasonable to assume that they might be promising candidates against cardiovascular deconditioning in the future.
The reciprocal translocation t(12;21)(p13;q22), the most common structural genomic alteration in B-cell precursor acute lymphoblastic leukaemia in children, results in a chimeric transcription factor TEL-AML1 (ETV6-RUNX1). We identified directly and indirectly regulated target genes utilizing an inducible TEL-AML1 system derived from the murine pro B-cell line BA/F3 and a monoclonal antibody directed against TEL-AML1. By integration of promoter binding identified with chromatin immunoprecipitation (ChIP)-on-chip, gene expression and protein output through microarray technology and stable labelling of amino acids in cell culture, we identified 217 directly and 118 indirectly regulated targets of the TEL-AML1 fusion protein. Directly, but not indirectly, regulated promoters were enriched in AML1-binding sites. The majority of promoter regions were specific for the fusion protein and not bound by native AML1 or TEL. Comparison with gene expression profiles from TEL-AML1-positive patients identified 56 concordantly misregulated genes with negative effects on proliferation and cellular transport mechanisms and positive effects on cellular migration, and stress responses including immunological responses. In summary, this work for the first time gives a comprehensive insight into how TEL-AML1 expression may directly and indirectly contribute to alter cells to become prone for leukemic transformation.
Vehicle emissions have been identified as a cause of air pollution and one of the major reasons why air quality in many large German cities such as Berlin, Bonn, Hamburg, Cologne or Munich does not meet EU-wide limits. As a result, in the recent past, judicial driving bans on diesel vehicles have been imposed in many places since those vehicles emit critical pollutant groups. For the increasing urban population, the challenge is whether and how a change of the modal split in favor of the more environmentally and climate-friendly public transport can be achieved.
This paper presents the case of the Federal City of Bonn, one of five model cities sponsored by the German federal government that are testing measures to reduce traffic-related pollutant emissions by expanding the range of public transport services on offer. We present the results of a quantitative survey (N = 14,296) performed in the Bonn/Rhein-Sieg area and the neighboring municipalities as well as the ensuing logistic regressions confirming that a change in individual mobility behavior in favor of public transport is possible through expanding services. Our results show that individual traffic could be reduced, especially on the city's main traffic axes. To sustainably improve air quality, such services must be made permanently available.
Until recently, studies regarding e-banking transactions have focused more on motivational factors that trigger the intention to accept and use the e-banking transaction, rather than the de-motivational factors that propel the action. However, in the developing countries like Sub-Sahara economies, the factors associated with the former have not been explored and are still rudimentary in the literature. Drawing from the Technology Threat Avoidance Theory (TTAT), the study seeks to examine the impact of online identity theft on customers’ willingness to engage in e-banking transactions in Ghana. A quantitative survey of 393 valid responses from retail bank customers amongst two leading commercial banks in Ghana for the analyses. Results from the PLS-SEM showed that the research constructs; perceived online identity theft’ positively and significantly predict “fear of financial loss”, “fear of reputational damage”, and “security and privacy concern” whilst the former has a negative mediated-relationship between perceived online identity theft and the intention to engage in e-banking transaction. This study is the first of its kind that has extended the application of the TTAT framework into the study of e-banking transactions. The study serves as a practical tool that will enable the banks in their quest to assess customers’ restriction/aversion towards the use of Fintech while ensuring sustainable growth of e-banking transactions in an emerging economy context. The study is limited to only banking institutions in Ghana without considering other players in the financial sub-sector. Future research direction has been suggested in the concluding part of the paper.
Isovaleric acidemia (IVA), due to isovaleryl-CoA dehydrogenase (IVD) deficiency, results in the accumulation of isovaleryl-CoA, isovaleric acid and secondary metabolites. The increase in these metabolites decreases mitochondrial energy production and increases oxidative stress. This contributes to the neuropathological features of IVA. A general assumption in the literature exists that glycine N-acyltransferase (GLYAT) plays a role in alleviating the symptoms experienced by IVA patients through the formation of N-isovalerylglycine. GLYAT forms part of the phase II glycine conjugation pathway in the liver and detoxifies excess acyl-CoA’s namely benzoyl-CoA. However, very few studies support GLYAT as the enzyme that conjugates isovaleryl-CoA to glycine. Furthermore, GLYATL1, a paralogue of GLYAT, conjugates phenylacetyl-CoA to glutamine. Therefore, GLYATL1 might also be a candidate for the formation of N-isovalerylglycine. Based on the findings from the literature review, we proposed that GLYAT or GLYATL1 can form N-isovalerylglycine in IVA patients. To test this hypothesis, we performed an in-silico analysis to determine which enzyme is more likely to conjugate isovaleryl-CoA with glycine using AutoDock Vina. Thereafter, we performed in vitro validation using purified enzyme preparations. The in-silico and in vitro findings suggested that both enzymes could form N-isovaleryglycine albeit at lower affinities than their preferred substrates. Furthermore, an increase in glycine concentration does not result in an increase in N-isovalerylglycine formation. The results from the critical literature appraisal, in-silico, and in vitro validation, suggest the importance of further investigating the reaction kinetics and binding behaviors between these substrates and enzymes in understanding the pathophysiology of IVA.
The future of work
(2021)
Driven by the exponential increase in the computational power of machines, data digitalization and scientific advancement in robotics and automation, the current wave of technological change is seemingly unprecedented in speed and scale. It transforms manufacturing and businesses making them more flexible, decentralized and efficient (Lasi et al. 2014). Even though technological change is nothing new, some argue that it is different this time. The new technologies have not only the potential to substitute labor (Nomaler and Verspagen 2018), they also change the way people work. The trend towards new forms of employment is no longer a marginal phenomenon.
Self-motion perception is a multi-sensory process that involves visual, vestibular, and other cues. When perception of self-motion is induced using only visual motion, vestibular cues indicate that the body remains stationary, which may bias an observer’s perception. When lowering the precision of the vestibular cue by for example, lying down or by adapting to microgravity, these biases may decrease, accompanied by a decrease in precision. To test this hypothesis, we used a move-to-target task in virtual reality. Astronauts and Earth-based controls were shown a target at a range of simulated distances. After the target disappeared, forward self-motion was induced by optic flow. Participants indicated when they thought they had arrived at the target’s previously seen location. Astronauts completed the task on Earth (supine and sitting upright) prior to space travel, early and late in space, and early and late after landing. Controls completed the experiment on Earth using a similar regime with a supine posture used to simulate being in space. While variability was similar across all conditions, the supine posture led to significantly higher gains (target distance/perceived travel distance) than the sitting posture for the astronauts pre-flight and early post-flight but not late post-flight. No difference was detected between the astronauts’ performance on Earth and onboard the ISS, indicating that judgments of traveled distance were largely unaffected by long-term exposure to microgravity. Overall, this constitutes mixed evidence as to whether non-visual cues to travel distance are integrated with relevant visual cues when self-motion is simulated using optic flow alone.
This study investigates the effects of four multifunctional chain-extending cross-linkers (CECL) on the processability, mechanical performance, and structure of polybutylene adipate terephthalate (PBAT) and polylactic acid (PLA) blends produced using film blowing technology. The newly developed reference compound (M·VERA® B5029) and the CECL modified blends are characterized with respect to the initial properties and the corresponding properties after aging at 50 °C for 1 and 2 months. The tensile strength, seal strength, and melt volume rate (MVR) are markedly changed after thermal aging, whereas the storage modulus, elongation at the break, and tear resistance remain constant. The degradation of the polymer chains and crosslinking with increased and decreased MVR, respectively, is examined thoroughly with differential scanning calorimetry (DSC), with the results indicating that the CECL-modified blends do not generally endure thermo-oxidation over time. Further, DSC measurements of 25 µm and 100 µm films reveal that film blowing pronouncedly changes the structures of the compounds. These findings are also confirmed by dynamic mechanical analysis, with the conclusion that tris(2,4-di-tert-butylphenyl)phosphite barely affects the glass transition temperature, while with the other changes in CECL are seen. Cross-linking is found for aromatic polycarbodiimide and poly(4,4-dicyclohexylmethanecarbodiimide) CECL after melting of granules and films, although overall the most synergetic effect of the CECL is shown by 1,3-phenylenebisoxazoline.
Pollution with anthropogenic waste, particularly persistent plastic, has now reached every remote corner of the world. The French Atlantic coast, given its extensive coastline, is particularly affected. To gain an overview of current plastic pollution, this study examined a stretch of 250 km along the Silver Coast of France. Sampling was conducted at a total of 14 beach sections, each with five sampling sites in a transect. At each collection site, a square of 0.25 m2 was marked. The top 5 cm of beach sediment was collected and sieved on-site using an analysis sieve (mesh size 1 mm), resulting in a total of approximately 0.8 m3 of sediment, corresponding to a total weight of 1300 kg of examined beach sediment. A total of 1972 plastic particles were extracted and analysed using infrared spectroscopy, corresponding to 1.5 particles kg−1 of beach sediment. Pellets (885 particles), polyethylene as the polymer type (1349 particles), and particles in the size range of microplastics (943 particles) were most frequently found. The significant pollution by pellets suggests that the spread of plastic waste is not primarily attributable to tourism (in February/March 2023). The substantial accumulation of meso- and macro-waste (with 863 and 166 particles) also indicates that research focusing on microplastics should be expanded to include these size categories, as microplastics can develop from them over time.
Background: Since presenteeism is related to numerous negative health and work-related effects, measures are required to reduce it. There are initial indications that how an organization deals with health has a decisive influence on employees’ presenteeism behavior.
Aims: The concept of health-promoting collaboration was developed on the basis of these indications. As an extension of healthy leadership it includes not only the leader but also co-workers. In modern forms of collaboration, leaders cannot be assigned sole responsibility for employees’ health, since the leader is often hardly visible (digital leadership) or there is no longer a clear leader (shared leadership). The study examines the concept of health-promoting collaboration in relation to presenteeism. Relationships between health-promoting collaboration, well-being and work ability are also in focus, regarding presenteeism as a mediator.
Methods: The data comprise the findings of a quantitative survey of 308 employees at a German university of applied sciences. Correlation and mediator analyses were conducted.
Results: The results show a significant negative relationship between health-promoting collaboration and presenteeism. Significant positive relationships were found between health-promoting collaboration and both well-being and work ability. Presenteeism was identified as a mediator of these relationships.
Conclusion: The relevance of health-promoting collaboration in reducing presenteeism was demonstrated and various starting points for practice were proposed. Future studies should investigate further this newly developed concept in relation to presenteeism.
It is a euphemism to say that humans use tools. Humans possess a vast repertoire of tools they use every day. In fact, as language or bipedal locomotion, tool use is a hallmark of humans. Tool use has also been often viewed as an important step during evolution (van Schaik et al., 1999) or even as a marker of the evolution of human intelligence (Wynn, 1985). So a fundamental issue is, what are the cognitive and neural bases of human tool use? The present series of papers in this special topic represents the newest additions to that research topic.
Small, Medium and Micro Enterprises (SMMEs) are widely recognised as playing a pivotal role in economic development and job creation. This is particularly so in Africa, where SMMEs are responsible for 80% of all formal jobs. While this is recognised by various African continental and national developments plans, the nefarious practice of late payment, by especially governments, not only stunt the growth of SMMEs, but often-time leads to business failure. This article investigates the impact of late payment, with a specific focus on South Africa and touches on international good practice that may be employed to address this phenomenon.
Background: Bile acids, end products of the pathway for cholesterol elimination, are required for dietary lipid and fatsoluble vitamin absorption and maintain the balance between cholesterol synthesis in the liver and cholesterol excretion. They are composed of a steroid structure and are primarily made in the liver by the oxidation of cholesterol. Cholesterol is also highly abundant in the human ovarian follicle, where it is used in the formation of the sex steroids.
Methodology/Principal Findings: Here we describe for the first time evidence that all aspects of the bile acid synthesis pathway are present in the human ovarian follicle, including the enzymes in both the classical and alternative pathways, the nuclear receptors known to regulate the pathway, and the end product bile acids. Furthermore, we provide functional evidence that bile acids are produced by the human follicular granulosa cells in response to cholesterol presence in the culture media.
Conclusions/Significance: These findings establish a novel pathway present in the human ovarian follicle that has the capacity to compete directly with sex steroid synthesis.